KEGG   Juglans regia (English walnut): 108985837Help
Entry
108985837         CDS       T05245                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 3
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
jre  Juglans regia (English walnut)
Pathway
jre03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:jre00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    108985837
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:jre03032]
    108985837
   03036 Chromosome and associated proteins [BR:jre03036]
    108985837
   03400 DNA repair and recombination proteins [BR:jre03400]
    108985837
Enzymes [BR:jre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     108985837
DNA replication proteins [BR:jre03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     108985837
Chromosome and associated proteins [BR:jre03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    108985837
DNA repair and recombination proteins [BR:jre03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     108985837
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP PADR1 PARP_reg WGR BRCT BRCT_2 PTCB-BRCT BRCT_3
Motif
Other DBs
NCBI-GeneID: 108985837
NCBI-ProteinID: XP_018813821
UniProt: A0A2I4E344
Position
Unknown
AA seq 812 aa AA seqDB search
MKVHGTRSHARAAEEDKVLTRKQKAAESNEQEAVQSPKKPKPENHNTQINGRSADEIAAE
FEEFSKAIREHLSIQQMREILEANGQDSSGPVFDIISRCQDLLFYGPLERCPVCNGNLEY
ARTRYKCTGFYSEWSSCTFSTKDPPRKQEPTKLPDSVLKSPVADLIKKYQDPSRRPRRNL
VIINKPFTGMVISLTGRLSRTHDYWRKEIEKHGGKVSNSVIGVTCLVASQAERERGGSFK
LAEAMERGVPVVSEAWLIDSIQKKDPQPLEAYDIVSDLLVDGKGIPWNKQDPREEAFESL
TTELKVFGKRGVHKDTKLQEKGGKIFEEDGILYNCAFNLCDLGRGLNDYCVLQLISVPGS
CLHLFYKKGRVGDDPNAEESLEEWENMDNAVKEFVRLFEEVTGNEFEPWEREKKFQKKPL
KFYPVDMDDGVEVRHGGLRLRQLGAAVAHCKLDPLVANFMKVLYSQGIYKYALMEMGYDP
ADLPIGMVTTFHLKKCEEVLQEFIDKVKSLKETGHKAEAVWSDYSQRWFNLMQSTRPFIL
RNCQEIADHAAAALETVRDITVASHIIGDMSGPTLDDPLSDRYQKLGCSISPLDKGTDDY
KMIQKYLDRTYEPVKVGDIEYDVTVERIFAVESNALPSYDEIKKLPNKVLVWCGTRSSNL
LRHLHQGFLPAICQLPVRSYMFGPAIVCSDAAAEAARYGFTAVDRPEGFLVLAIASLGNQ
VMEAKKAPEDTKAFQDKKIGVKGLGRTKTDESEYFIWKDDIKVPCGRLVPSGHQDSPIEY
NEYAVYDPKLVSIRFVVEVKYDEKGVVMDTEE
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttcatgggacgcgatctcatgctcgcgctgccgaagaagataaggtattgacg
aggaagcaaaaggctgcagaaagcaacgaacaggaagctgtgcaatctccaaaaaagcca
aagcccgaaaatcataacacccagattaatggaagatctgcagatgaaatagctgctgag
tttgaagagttctctaaagccattagagagcacctctccatccaacaaatgcgggaaata
ctggaggctaatggccaagattcctctggccctgtttttgatattatctctagatgccaa
gacttactgttttatgggccattggagagatgcccagtttgcaatggcaatctggaatac
gcgcgcacacgctataaatgcacagggttttatagtgagtggtcttcttgcaccttcagc
acaaaggatcctccaaggaaacaagaaccaaccaaactaccagattctgttctcaaatcc
cctgttgcagacttaataaagaagtatcaagatccaagtcgccggcctcgaaggaattta
gtcataatcaataaaccttttacagggatggtgatttctctaacgggccgtctttctcga
acacatgattattggagaaaagagattgaaaagcatggggggaaagtttccaactccgtg
attggtgtaacttgtttggttgcttctcaggctgagagagaacgtggtggttcattcaaa
cttgcggaagcaatggagagaggcgtacctgttgtaagcgaagcttggttgatagatagc
attcagaaaaaggatccacagcctcttgaagcttatgatattgttagtgatcttttggta
gatgggaaagggattccatggaataaacaagatcctagagaagaggcattcgaatcactc
acgactgaactaaaggtttttggcaagagaggagtgcacaaggatactaaattgcaggag
aaaggtggaaagatctttgaagaagatgggatactatataattgtgcttttaatctttgc
gacttagggagaggactgaacgactattgtgtcttgcaactcatctcagtaccagggagc
tgcttgcatctgttctataagaaagggagagttggtgatgatccaaatgcagaggagagc
cttgaggagtgggaaaatatggataatgctgtgaaagaatttgtaaggctctttgaggaa
gtaactggaaatgagtttgagccctgggaaagagagaagaagttccaaaagaagccactc
aagttttatcctgtagacatggatgatggagttgaagtcagacatggaggtcttcgtctt
cggcagctaggagctgcagtcgctcactgcaaacttgatcctttggttgccaatttcatg
aaggttttgtacagtcagggaatatacaagtacgcattaatggagatggggtatgaccct
gcagatctaccaatagggatggtcactacttttcacttaaaaaagtgtgaggaggttctg
caggagttcattgataaagtgaaatcattgaaagagacagggcataaggctgaggctgtt
tggtccgattatagccaaagatggttcaatctgatgcaatccactaggcctttcatctta
aggaactgccaagaaattgcagatcatgctgcagcagctttagagactgttcgagatata
actgtggcttcacacattataggagacatgagtggccctacccttgatgaccctttgtcg
gatcgataccagaaactaggctgctcaatctccccactggataaagggacggatgactac
aagatgatccagaagtatctggatagaacttatgaacctgtcaaagttggagatattgaa
tatgatgtgaccgttgagcgtatatttgcagtagaatcgaatgcgctcccttcttacgat
gaaataaagaagttaccaaacaaagtccttgtgtggtgtggcacgcgcagctcaaatctg
ttgaggcacttgcatcaaggcttcttaccagcaatatgccagctccctgtccggagttat
atgtttgggccggcgatcgtctgctctgatgctgcagccgaagctgctagatatggtttc
actgcggtagacaggccagaagggttcttggtcctcgcaattgcttctctaggaaatcaa
gttatggaagcaaagaaggcacccgaggacaccaaggctttccaagataagaagatcggg
gtgaaaggattgggtcgaacgaagacggatgaatcagaatacttcatttggaaagatgac
atcaaagttccttgtggtcgactggttccctcgggtcaccaagatagcccaattgagtat
aatgagtatgcagtttacgatcctaaactggtgagcataaggttcgtggtggaggtgaag
tacgatgagaagggtgtggtgatggacacagaggagtga

DBGET integrated database retrieval system