KEGG   Juglans regia (English walnut): 108987422Help
Entry
108987422         CDS       T05245                                 

Definition
(RefSeq) acid beta-fructofuranosidase-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00052  Galactose metabolism
jre00500  Starch and sucrose metabolism
jre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108987422
   00500 Starch and sucrose metabolism
    108987422
Enzymes [BR:jre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     108987422
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 108987422
NCBI-ProteinID: XP_018815884
UniProt: A0A2I4E924
Position
Unknown
AA seq 655 aa AA seqDB search
MGGSSTIPSHTRITTTTSDLENAAYAPLPGHSSPASPRRPLKGFAGIIVSVIFLLALVAL
ILDQSQEPLDKPGKDEAPTLTSNATSFSNISGPVARGVAQGVSAKSNPSFSGHELSYNWT
NAMFSWQRTAFHFQPERNWMNDPDGPLYHKGWYHLFYQYNPDSAVWGNITWGHAVSTDLI
HWLYLPIAMVPDSWFDWNGVWTGSATILPDGQIVMLYTGDTDNYVQVQNLAYPANLSDPL
LLDWVKYSGNPVLVPPTGIAPKDFRDPTTAWLGPDGKWRLTIGSKVNTTGISLVYTTTNF
TDYELLDTVLHAVPGTGMWECVDFYPVSINGTKGLDTSAGGPGVKHVLKASLDNTKLDYY
ALGTYFAENDTWVPDDPEQDVGIGLRYDYGRYYASKTFYDPVKERRILWGWINETDTEND
DLAKGWASVQTIPRTVLYDNNTGTNILQWPVEELESLRLNSTDFDGVVVEPGSVVELDIG
SATQLDILAEFEIESLGLEETNEVNGLCGSGATDRSSFGPFGLLVIADETLSELTPIYFR
LANSSDGSFETYFCADERRSSKASDVFKQVYGSSVPVLDGETLSMRILVDHSIVESFAQG
GRRVITSRLYPTEAIYGAARLFLFNNATGVNVKATLKIWQLNYAFIHPFPLDQMH
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgggcggtagtagtaccataccttcccacaccagaatcactactactacttctgatctt
gaaaatgccgcttacgctcccttacctggccactcctctccagcgagtccccggagacct
ttaaagggttttgccgggatcattgtctccgtcatttttctcctggcattggtcgcatta
atccttgaccaaagccaagaacccttggataaacccggaaaggatgaggcacctacattg
acgtccaacgctacgtctttttccaacatttcgggaccggtggctaggggagtcgcacaa
ggcgtgtccgccaaatccaacccgtccttttccggccatgaactttcttacaactggaca
aacgctatgttttcttggcagagaactgccttccattttcaacccgaaaggaactggatg
aatgatcctgatggtccactgtatcacaagggatggtaccatctgttttaccaatacaac
ccggattcggctgtgtggggcaacatcacatggggtcacgccgtctccaccgatctcatc
cactggctctatctccccatcgccatggttcccgacagctggttcgattggaacggcgtc
tggactggctccgccaccatccttcccgacggccagatcgttatgctctataccggagac
accgataattacgttcaggttcaaaaccttgcctaccctgccaacctttccgatcctcta
ctcttggattgggtcaagtactccggtaacccagtcttggtcccccctaccggcattgcc
cccaaagatttccgagacccgactaccgcctggcttggacccgacgggaagtggcggctc
acaatcgggtccaaggtcaatactacgggcatttcgcttgtgtacacgaccacgaacttc
accgactatgagctgttggatactgtgttgcacgccgtccccggtacaggcatgtgggag
tgcgtggatttttacccggtctcgatcaatgggacgaaaggtttggatacgtcggcgggc
ggcccgggagttaagcacgtgttgaaggctagtttggataataccaagttggattactat
gcacttggaacttactttgcagagaacgatacgtgggtgcccgatgacccggaacaggat
gtgggtatcgggttgcgatatgactatgggaggtactatgcatcgaagacattttatgac
ccggtgaaggagaggcggatcctatggggttggatcaatgaaaccgatactgaaaatgac
gacctggcaaagggttgggcgtctgttcagaccattccaagaactgtgttgtatgacaat
aatactggaaccaatattcttcaatggcccgtggaagagttagagagcctgagactgaac
agcacagattttgatggggtggtggtcgaacctggatcggttgtggagctagacatcggc
tcagccactcagttagacattctcgccgagtttgaaatagaatcattaggattggaggag
acgaacgaagtcaatggactttgtggaagtggtgccactgacagaagcagtttcgggcca
tttgggcttttagttattgctgatgaaacactttctgaactaacccctatatatttccgc
cttgccaattcaagtgatggcagttttgagacttacttctgcgcggatgaaagaaggtct
tcaaaggcttctgatgttttcaaacaagtttacggaagttcagttccggtgcttgatggt
gaaactttgtcgatgagaattttggttgaccattcaattgtggaaagctttgctcaagga
gggaggagagtgattacatctcgtctttatccaacagaagcaatttacggagcagctaga
ttatttttgttcaacaatgcaactggagtgaatgtcaaggccacgcttaagatatggcag
ttgaattatgcttttattcaccctttccccttggaccagatgcattga

DBGET integrated database retrieval system