KEGG   Juglans regia (English walnut): 108988923Help
Entry
108988923         CDS       T05245                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase isoform X1
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00511  Other glycan degradation
jre00600  Sphingolipid metabolism
jre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    108988923
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    108988923
Enzymes [BR:jre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     108988923
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N EF-hand_5
Motif
Other DBs
NCBI-GeneID: 108988923
NCBI-ProteinID: XP_018817869
UniProt: A0A2I4EEN9
Position
Unknown
AA seq 948 aa AA seqDB search
MLEKVFIEEERDSSKSSTNKVDPGKPASLTWQRILNSEGRALSQFTLSLKEMVQMAPIGF
RLWRHVRDEEAKGNGVFINPFAKRLVTSCHGIPLGGIGAGSIGRSYRGEFQRWQLFPRIC
EEKPVLANQFSVFVSRSNGEKYSTVMCPRSPELLEENAVSGIGSWDWNLNGHNSTYHALF
PRAWTVYEGEPDPELRIVSRQISPVIPHNYKESSFPVSVFTFTLYNSGKTAADVTLLFTW
ANSVGGLSGFSGQHCNSKVMMKDGVHSVLLHHNTANGLPPVTFAIAAEETDGVHVSECPC
FVISGNSQGISAKDMWQEIKEFGSFDRLNSSEPSVPSATGSSVGAAIAASVTIPSNAVRS
ATFSLAWDCPEVNFLSGKSYYRRYTKFYGTRGDAAAKIAHDAILEHGHWESQIEAWQRPI
LEDKRLPEWYPITLFNELYYLNSGGTIWTDGSPPMHTLVSIVKRKFSLDRSSSGLKDIID
VPPQNDTAADILERMTLILEQIHTTISSNSAFGTNLLQKGEENIGQFLYLEGIEYHMWNT
YDVHFYSSFALVMLFPKLELSIQRDFAAAVMMHDPNKIKLLHDGQWVPRKVLGAVPHDIG
INDPWFEVNAYNLYNTDRWKDLNPKFVLQVYRDVVATGDKKFAEAVWPSVYVAMAYMDQF
DKDRDGMIENEGFPDQTYDTWSASGVSAYSGGLWVAALQAASAMAHEVGDKGSEDYFWFK
FQKAKGVYEKLWNGSYFNYDSSGGSSSSSIQADQLAGQWYARACDLFPVVDQDKARSALQ
KVYNYNVLKVKDGRRGAVNGMLPDGKVDFSSMQSREIWSGVTYAVAATMIHEDMFDMAFQ
TAGGVYEAAWSKEGLGYSFQTPEGWTTEEQYRSLCYMRPLAIWAMQWALTRPTTMEPEMK
AEVKEDSLFRAHSGFSKVSRLLKLPEERTRRRSFVQAVYEYTRKRIGM
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaaaggtttttattgaagaagagagggactcctctaagtcttcaactaataag
gttgatcctgggaagcctgcatcactgacctggcagcggattttaaacagtgagggaaga
gccctttcgcagttcactctaagtttgaaagagatggttcagatggctccgataggattt
cgactgtggcgccatgtccgagatgaggaagctaaaggaaatggggtttttataaatcca
tttgctaagcgccttgtaacatcttgtcatggcattcccttaggtggtataggtgcagga
agcattggaagaagttacagaggtgagtttcagcgctggcaactattccctagaatatgt
gaagaaaaaccagttttagcaaatcagttttcggtatttgtttcgcgctcaaatggtgaa
aaatattctacagtaatgtgcccaaggagccccgagctgcttgaagaaaatgcagtttca
gggattggatcttgggactggaatctgaatggacataactctacatatcatgctctattc
ccaagggcttggactgtatatgagggtgaacctgatccggaacttagaatagtttctcgt
caaatctcacctgttatcccccataattacaaggagagcagcttccccgtctcagttttt
actttcacgctgtacaattctggaaagactgctgcagatgtcaccttgcttttcacatgg
gcaaattctgtcggtggtctttctggattttctggtcagcactgcaattcaaaagtcatg
atgaaggatggtgtgcacagtgtacttctgcaccacaatactgcaaatggactaccccct
gtgacctttgcaattgcagcagaggagactgatggagttcatgtctctgagtgcccttgc
tttgtgatatcaggtaactctcagggtatctcagcaaaagacatgtggcaggaaataaag
gagtttggatcctttgaccgcctcaattcctccgagccatcagtgccttcagcaacagga
tcatctgttggggcagccattgctgcttctgttacaattccatcaaatgcagtacgttct
gctacattctcactggcatgggactgccctgaagtaaattttttgagtggaaaatcttat
taccggcgttacactaagttttatggtactcgtggtgatgctgctgcaaagattgcacat
gatgccattcttgagcatggccattgggagtcccagatagaagcatggcaaagacccatt
cttgaagacaagcgacttcctgaatggtatcccattactctctttaatgagctctattat
ctaaattcagggggtacaatttggacagatggatcacccccgatgcatactttagtgagc
attgtcaaaaggaagttttcccttgacaggtccagttcaggtctgaaggacattattgat
gtaccccctcaaaatgatactgctgctgatattcttgaaaggatgactttaatactcgag
caaattcacaccacaatttcatcaaattctgcatttggaacaaatctgcttcaaaaagga
gaagaaaacattgggcaattcctttatcttgaagggattgaatatcacatgtggaacacc
tatgatgttcatttctactcgtcttttgcactagtcatgctatttccaaaactcgaactt
agcatccaaagggactttgcagcggcagtaatgatgcatgatcccaataagattaaactt
ttacatgatggacagtgggtcccaagaaaggttctaggagctgttcctcatgatattgga
ataaatgatccatggtttgaagtaaatgcttataacctttataacactgataggtggaag
gacttgaatccaaaatttgttctccaagtttacagggatgtggttgccacaggtgataag
aagtttgcagaagctgtttggccgtctgtttatgtcgcaatggcttatatggaccaattt
gacaaggacagagatgggatgattgagaatgaaggcttccctgatcaaacttatgatacg
tggtctgcatctggtgtgagtgcatatagtggtgggttgtgggtggcagccttgcaggct
gcatcggccatggcacatgaagtaggtgataagggttctgaagattacttttggtttaag
tttcagaaggcaaaaggtgtgtatgagaaactatggaatggttcttactttaattatgac
agcagtggaggaagttcaagttcatctattcaagctgatcaattggctggacaatggtat
gctagagcatgtgatctttttccagttgttgatcaagacaaggcaagaagtgcactgcaa
aaggtctataattacaatgtcttaaaggtgaaggatggaaggaggggggctgtcaacggg
atgctacctgatggaaaggtcgacttctcttccatgcaatcgagagaaatatggtctgga
gtcacttatgctgttgctgcgacaatgatccacgaagatatgtttgatatggcatttcag
actgcaggtggagtctatgaagctgcatggtccaaggaaggacttggttattcctttcag
acacctgaaggttggacgaccgaggagcaatacagatccctatgttacatgcggcctttg
gctatatgggcgatgcagtgggctttaacgagaccaacaaccatggagccagagatgaaa
gcagaagtgaaggaagattctctgtttagggcgcattctggattctcaaaagtttctcga
cttttaaagttgcccgaagagagaacgcgtagaagaagttttgtacaggctgtatatgaa
tacactaggaagaggattgggatgtaa

DBGET integrated database retrieval system