KEGG   Juglans regia (English walnut): 108989385Help
Entry
108989385         CDS       T05245                                 

Definition
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
jre  Juglans regia (English walnut)
Pathway
jre03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:jre00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108989385
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:jre03041]
    108989385
Enzymes [BR:jre01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     108989385
Spliceosome [BR:jre03041]
 Complex C
  Other components
   Step II factors
    108989385
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C AAA_22 DEAD AAA_30 AAA_19 T2SSE FtsK_SpoIIIE DUF2075 AAA_23 ATPase AAA_29
Motif
Other DBs
NCBI-GeneID: 108989385
NCBI-ProteinID: XP_018818506
UniProt: A0A2I4EGI1
Position
Unknown
AA seq 713 aa AA seqDB search
MPSMAQGGRLRDPTENPNKLHDRKLDAFSGKQNLAQHRKSLPIASVEKRLVDEVRHNDTL
IIVGETGSGKTTQLPQFLFNAGFCRDGKTIGITQPRRVAAVTVAKRVAEECGVELGQRVG
YSIRFEDATSISTRIKYMTDGLLLREALLDPYLSRYSVIIVDEAHERTVHTDVLLGLLKN
IQRARSKSFNDRVNIEKNKENNGTLSDKDNGVFLKQCQSRKFPPLKLIIMSASLDARGFS
EYFGGARAVHVQGRQFPVDTFYTHHAEPDYLDAALITIFQIHLEEGPGDILVFLTGQEEI
ESVERLVKERLQQLPEGSRKLLTVPIFSALPSEKQMRAFRHAPAGFRKVILATNIAETSV
TIPGIKYVIDPGLVKARSYDPVKGMESLIIVPISKSQALQRSGRAGREGSGKCFRLYPES
EFDKLEDSTKPEIKRCNLSNVILQLKALGVDDILGFDFMDKPSRASIVKSLEQLFLLGAL
TDECKLSDPVGRQMAQLPLDPVYSRALILASQFNCLEEMLITVAMLSVESIFYGPREKLE
EARTAMRRFSSPEGDHLSLVNVYHASDELLDKRMVGLSKEKKDKILSKWCKENFINSRSL
RHARDIHSQIRGHVEQMGLRVASCGDDMLQFRRCLAASFFLNAALRQPEGTYRALASGQV
VQIHPSSVLFRAKPECIVFNELVQTNHKYIRNISRIDYLWLSELAPHYYCTQN
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgccttcaatggctcaaggaggacgactccgagaccctaccgaaaaccctaataaactt
cacgaccgcaagctcgacgccttttccgggaagcaaaatcttgcgcaacatagaaagtct
cttccgatcgcttccgtcgagaaacgacttgtggatgaggtccgtcacaatgatactttg
attattgttggtgaaactggaagtggaaaaactacccagttgccacagtttctatttaat
gcgggattttgtcgggatgggaaaactattgggattactcagcctagacgtgttgcggct
gttactgttgcaaaacgggttgctgaggaatgtggcgtggagttgggccaaagggttggg
tattccattagatttgaggatgcgacttccatctcaacgaggatcaaatacatgacagat
ggattgctactaagggaagcattgttagatccatatctctctagatattcagtcatcatt
gttgatgaagcccacgagaggactgtccacactgatgttttgctgggattgcttaaaaat
atacaacgagcaaggtcaaaatctttcaatgaccgtgttaatattgaaaaaaataaggaa
aacaatggcactctgtcggataaggacaatggtgtttttctcaagcaatgccaaagcaga
aaatttcctccattgaagttaattatcatgtctgcgagtttagatgcacgtggtttttcc
gagtacttcggcggtgcaagagctgttcatgtccaagggcgacaatttcccgtggataca
ttttacacccatcatgctgagccggattatttagacgcagccttaattaccatattccag
attcatctggaggaaggccctggtgatatacttgtatttttgactgggcaagaggagatt
gaatcagttgaacgacttgtaaaagagcgacttcaacagttacctgaaggcagtcgaaag
ctgttaaccgttcccatattttcagctcttccctcagaaaagcaaatgcgagcatttaga
catgctccagccggtttccgtaaggtaatattagcaacaaatattgctgagacatcagtg
acaatacctggaatcaagtatgttatagatcctggacttgtaaaagcacggtcgtatgat
ccggtcaaaggaatggaatctttgatcattgttccaatatcaaaatcacaggctcttcaa
aggagtggacgagcaggtcgtgaaggatctggaaagtgctttcgtctctacccggagagt
gaatttgataaacttgaggattcaacaaagcccgagataaaacgatgcaacctctctaat
gtcattttgcagctcaaggctttgggtgtcgatgatattcttgggtttgacttcatggac
aaaccgtcaagggcatctattgtcaagtcattggagcaattattcttgctaggtgcttta
acagatgaatgtaaactgtcagatccagtaggccgtcaaatggctcagctccccttagac
cctgtttattccagagctcttattttggctagtcagttcaactgcttggaagaaatgttg
ataactgtagcgatgctctcagtggaatctattttttatggccctcgtgagaagttagaa
gaggcaagaactgcaatgagacgcttttcaagtccagagggagaccacctcagtttggtt
aacgtgtaccatgcctctgatgagttattggataagagaatggtggggctcagcaaagag
aaaaaggataaaattctgagcaagtggtgcaaggaaaatttcatcaatagtcgttccttg
agacatgctcgtgacattcacagtcaaattcgaggtcatgttgaacaaatgggtcttcgt
gttgcttcttgtggagatgacatgcttcagttccgcagatgtctcgctgcttcatttttc
ctcaatgcagctttgaggcagccagagggaacatatagggctttagcaagtggtcaggtg
gtgcagatccacccttcttctgtattattccgagcaaaaccagagtgtatagttttcaac
gaactagtccaaactaatcataagtacatccgcaacattagtagaatcgattacttgtgg
ctatctgaactggctcctcattattattgcacacaaaattaa

DBGET integrated database retrieval system