KEGG   Juglans regia (English walnut): 108990273Help
Entry
108990273         CDS       T05245                                 

Definition
(RefSeq) tyrosine decarboxylase 1-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00350  Tyrosine metabolism
jre00360  Phenylalanine metabolism
jre00380  Tryptophan metabolism
jre00950  Isoquinoline alkaloid biosynthesis
jre00965  Betalain biosynthesis
jre01100  Metabolic pathways
jre01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    108990273
   00360 Phenylalanine metabolism
    108990273
   00380 Tryptophan metabolism
    108990273
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    108990273
   00950 Isoquinoline alkaloid biosynthesis
    108990273
   00965 Betalain biosynthesis
    108990273
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:jre04147]
    108990273
Enzymes [BR:jre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     108990273
    4.1.1.105  L-tryptophan decarboxylase
     108990273
Exosome [BR:jre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108990273
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2 DUF1148
Motif
Other DBs
NCBI-GeneID: 108990273
NCBI-ProteinID: XP_018819733
UniProt: A0A2I4EK10
Position
Unknown
AA seq 562 aa AA seqDB search
MDAFNFNHEFMMKHSSSYDTNNPLDPEEFRRQGHMIIDFLADYYLNIEKYPVLSQVEPGY
LRKRLPESTPYNPESIETILQDVQDHILPGVTHWQSPSYFAYFPSSGSIAGFLGEMLSTG
FNVVGFNWISSPAATELESIVMDWLGEMLQLPKSFLFSGNGGGVLQGTTCEAILCTLVAA
RDQMLRRIGSQNMGKLVVYGSDQTHCSLQKAARIAGINPSNFRAIKTTKSTTFSLSPDSL
RSAICKDIDAGLIPLFLCATVGTTSTTAIDPLRSLCDVAKDYGLWVHVDAAYAGSVCICP
EFRHVIDGVEGANSFSLNAHKWFLTTLDCCCLWVKDPSALVKSLSTNPEYLRNKATDSRQ
VVDYKDWQLTLSRRFRSLKLWFVLRSYGVAKLRDFLRSHVNMAKLFEGFVTSDKRFEIVV
PRSFAVVCFRVLSPRMDNGVAYAKRTTNGHTNGHLNGHTNGHSNGHLNGHTNGHLNGHTN
GKGDDHDHDDHNYMKEESTNELNRKLLESINKAGRVFMTHSMVGGVFVIRFAVGATLVEE
KHVITAWKVVQEHANAILSENY
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggatgccttcaatttcaaccatgaattcatgatgaaacactcgtcttcctatgacaca
aataatccactagaccctgaggagttcaggcgtcaaggccacatgatcatagattttcta
gctgattattatttgaatatcgagaaatatcctgtccttagccaagtcgaaccaggttat
ctccgaaaacgcctgccagaatctaccccatataatcctgaatccattgaaaccattctc
caagacgtgcaggaccatatacttcccggtgtaactcattggcaaagccctagctatttt
gcttacttcccatccagcggaagcatagcagggtttcttggcgagatgctttccactgga
ttcaatgtggttggcttcaactggatttcgtcaccagctgcgactgagctagagtcaata
gtcatggattggctcggagagatgcttcagctgcccaagtctttccttttctcgggcaat
ggtgggggcgtgctacaagggactacttgtgaggccattttgtgcacactcgtcgctgct
agggatcaaatgttgcgccgcattgggagtcagaatatgggaaagttggtggtctatgga
tctgaccaaacgcattgttcacttcaaaaggcggcacggatagccggaatcaacccaagt
aatttcagagccatcaaaaccaccaagagcacgacattttcgttgtccccggactcccta
cgatcagccatttgcaaagatattgatgcaggcctaatccctttattcttgtgtgccact
gtggggacaacttcgacaactgcaattgatccactaaggtcgttatgcgatgttgccaaa
gattatggcttgtgggtccatgtcgacgctgcttatgctggaagcgtctgcatttgtcct
gagttccggcatgtcattgatggtgttgagggtgcaaactcttttagcctcaatgcacat
aaatggttcctaaccactttagattgctgctgcctttgggtcaaggacccgagcgccttg
gtaaaatcactctcaacaaatcctgagtacttgaggaataaggcaaccgattcaaggcaa
gtggtggactacaaagactggcagcttaccctaagccgaagattccgatctttgaaatta
tggttcgtgcttcgaagctatggcgtggctaagcttagggactttctgagaagtcatgtt
aacatggccaagctttttgaagggtttgtcacatccgacaagaggtttgaaattgttgtc
cctagaagctttgctgtggtttgctttagggttttgtccccaagaatggataacggcgta
gcatacgcaaaacgtactacaaatggtcatacaaatgggcacttaaacggtcatacaaac
gggcactcaaacgggcacttaaacggtcatacaaatgggcacctaaacggtcatacaaat
ggaaagggtgatgatcatgatcatgatgatcataactacatgaaagaagaaagtacaaat
gagctcaaccggaagttattggagtccattaacaaggcaggccgtgtttttatgactcat
tccatggttggcggtgtgttcgtgataaggtttgcagttggagcaactctagtggaagaa
aagcacgttatcacggcttggaaagtggtgcaggagcacgcaaatgccatacttagcgaa
aactactaa

DBGET integrated database retrieval system