KEGG   Juglans regia (English walnut): 108990864Help
Entry
108990864         CDS       T05245                                 

Definition
(RefSeq) hydroxymethylglutaryl-CoA synthase-like
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00072  Synthesis and degradation of ketone bodies
jre00280  Valine, leucine and isoleucine degradation
jre00650  Butanoate metabolism
jre00900  Terpenoid backbone biosynthesis
jre01100  Metabolic pathways
jre01110  Biosynthesis of secondary metabolites
Module
jre_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    108990864
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    108990864
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    108990864
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    108990864
Enzymes [BR:jre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     108990864
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_CoA_synt_C HMG_CoA_synt_N ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 108990864
NCBI-ProteinID: XP_018820512
UniProt: A0A2I4EM84
Position
Unknown
AA seq 468 aa AA seqDB search
MAKNVGILAVEIYFPPTCIQQESLEAHDGASKGKYTIGLGQDCMAFCTEVEDVISMSLTA
VTSLLEKYGIDAKEIGRLEVGSETVIDKSKSIKTFLMQIFEKSGNTDIEGVDSTNACYGG
TAALFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAILVGPDAPISFESR
FRGSHMAHAYDFYKPNLASEYPVVDGKLSQTCYLMAVDTCYRQFCKKYEKLEGKQFSLAD
AEYFVFHSPYNKLVQKSFARLLYNDFLRNASSVDEVAKEKLGPFSTLSLDESYQNRDLEK
ATQQLAKPLYNAKVQPTTLIPKQVGNMYTASLYAAFASLIHNKHTTLAGQRVVLFSYGSG
LTATMFSLKFQEGQHPFSLSNIATVMDVQRKLDSRHEYSPEKFVETMKLMEHRYGANDFV
TSQDISLLSPGTFYLTEVDTMYRRFYSQKAGDKANGTKCEKGSLVNGR
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaatgtgggaattctcgccgtggagatctacttccctcccacctgtattcaa
caggaatcattggaggctcatgatggtgccagtaaaggaaaatacacaattggactcggc
caagattgcatggccttttgtactgaggtggaagatgtaatctcaatgagtttgacagca
gttacatccctccttgagaaatatgggatcgatgccaaagaaattggtcgcctggaagta
ggcagtgagactgtaatagacaagagcaaatcaattaagaccttcttgatgcaaatcttt
gagaaaagtggaaacactgacattgaaggcgttgactcaactaatgcgtgctatggtgga
acagcagctttgttcaactgtgtcaattgggttgaaagtaattcatgggatgggcgctat
ggactcgttgtgtgcactgacagtgcggtctatgcagaaggaccagcccggccaactgga
ggagcagctgctattgccattctagtaggacctgatgctcctatttcttttgaaagcaga
ttcagggggagtcatatggctcatgcctatgatttttacaagccgaaccttgctagtgaa
tatccggttgttgatgggaaactttctcaaacatgttatctcatggctgttgatacttgc
tacagacagttctgcaagaagtacgagaaactagaaggcaaacaattttcgcttgctgat
gctgaatattttgtatttcattctccatataacaagcttgtacaaaaaagctttgctcgc
ttgttgtacaatgatttcttgaggaatgccagctctgttgatgaggttgctaaagaaaag
ctgggaccgttttccaccttatctctagatgaaagctaccagaaccgggaccttgaaaag
gcaacccagcaacttgcaaagcccctatacaatgcaaaggtgcagcctaccactttaata
ccgaagcaagttggcaacatgtacactgcgtctctctatgcagcatttgcatcccttatt
cacaataaacataccacattggcaggtcagcgggtggtactgttctcatatgggagtggc
ttaacagccacaatgttttcgttgaaattccaggagggtcaacatccctttagcttatca
aacattgccactgtgatggatgtccaaaggaaattggattcaaggcatgagtactcccca
gagaagtttgttgaaaccatgaagctaatggagcacaggtatggagccaacgactttgtg
acaagccaggacattagccttttatctccaggcacattctatcttactgaagttgacacc
atgtatcggagattctactcccagaaggctggggacaaggccaatggcaccaaatgtgag
aagggttctcttgtcaatggtcgctga

DBGET integrated database retrieval system