KEGG   Juglans regia (English walnut): 108991606Help
Entry
108991606         CDS       T05245                                 

Definition
(RefSeq) beta-fructofuranosidase, cell wall isozyme-like isoform X1
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00052  Galactose metabolism
jre00500  Starch and sucrose metabolism
jre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    108991606
   00500 Starch and sucrose metabolism
    108991606
Enzymes [BR:jre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     108991606
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 108991606
NCBI-ProteinID: XP_018821475
UniProt: A0A2I4EPZ7
Position
Unknown
AA seq 581 aa AA seqDB search
MAVSCIWLMFFFSLFGHGVLELVEVFHHVYLNVHQTAQYSTSGNQPYRTSYHFQPPKNWM
NDPNGPMLRLGIYHLFYQYNPKAAVWGSNVIWGHSTSTDLVNWTPHDPAIYPSQQSDING
CWSGSTTILPGGHPVILYTGIDTENRQVQNLAAPKNFSDPFLREWVKFKHNPLLTPNSKN
KINATYFRDPSTAWLGCDGNWRVIIGSQKKERGLAILFKSNDFVHWEEAEKPLYSANKDT
GMWECPDFYPVLIKSPLGIDTSSNGPDVRYVLKVSFFRTPHDYYMIGTYNPDKDIFIPDN
GPFKDSSLRYDYGKFYASKTFFDNKYPLHRRILWGWVNESSSAIDDIKKGWSGVQAIPRS
IWLDKSGKQLVQWPIKEIETLRGTQIELPYQVLSGGSVLEVSGLTAAQADVVISFEISDF
IKAEVLDPSWTNPQVICSRKDASVKGGLGPFGLLVLASEGLQEYTAVFYRIFKGHNKYVK
YVVLMCSDQNRSSLNQDNDKTTYGAFVDVDPVQEKLSLRSLIDHSIVESFGAEGKACITA
RVYPTLAINDAEAHLYVFNNGTENIGITRLSAWSMKKAQIN
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgtcttgtatctggctaatgttcttcttttccctctttggccatggtgttctt
gagctcgttgaggttttccaccatgtttacctaaacgtacatcaaactgcacaatattct
acttctgggaatcagccttaccgaacttcttatcacttccagcctcccaaaaattggatg
aatgatcctaatggaccaatgttacgattgggaatctaccatctgttctaccaatataac
ccaaaagctgcagtttggggcagcaatgttatctggggccactctacatcaacggatctc
gtgaattggaccccacatgatccagcaatctacccatcacagcagtctgatatcaacggc
tgctggtcgggttccaccacgatcctccccggaggccacccagtcatcctctacactgga
attgacactgagaatcgccaagtccaaaacttggctgcgcccaaaaacttttctgaccca
ttccttagggaatgggttaagtttaaacataatccactactgacacccaattccaagaac
aaaatcaatgcaacctatttcagagacccatccactgcttggcttggctgtgatgggaat
tggagagtgatcattgggagccaaaagaaagaacggggcttagcaattctctttaagagt
aatgattttgttcattgggaagaagctgaaaaaccactttactctgctaataaggacaca
ggaatgtgggaatgtcctgatttttatccagttttgatcaaaagcccacttggtattgac
acttcaagtaatggtccggatgtcagatatgtgctcaaggtgagcttctttaggacacca
catgattactacatgatcgggacttataacccggacaaggatatcttcattccggacaac
ggaccatttaaagactcgagcttgagatatgattatggaaaattttatgcctcaaagact
ttctttgacaacaagtacccactccacagaagaatcttgtggggttgggtaaatgaatct
tcaagtgccattgatgatatcaagaagggatggtctggagttcaggcgattccaaggagt
atttggctcgataaatctggaaaacaattggtgcaatggccaatcaaagaaattgaaacg
ttgcgtggaacccagattgagttgccttaccaggtgctgagtggcggatcggtgcttgaa
gtttctggtctcacagcagcacaggcagacgttgtgatttcatttgaaataagcgatttt
attaaagctgaagtgctggatccaagttggaccaacccacaagtaatttgtagtcgaaag
gatgcatcagttaaaggtggcctagggccctttgggttgctagttttggcttcggaaggc
ctgcaggaatatacagcagtattctacagaatattcaaaggccataacaaatatgtcaaa
tatgtggtgctgatgtgcagcgaccaaaacagatcttccttgaatcaagataatgataag
accacttatggggcatttgtggatgtggaccctgttcaggagaagctgtcactcagaagc
ttgattgatcactctatcgtggagagctttggtgcagaaggaaaggcttgcatcacagct
agggtttatcctacattggccattaatgatgctgaggctcacttgtatgttttcaataat
ggaactgagaatattgggatcaccagattgagtgcttggagcatgaagaaagctcaaata
aattga

DBGET integrated database retrieval system