KEGG   Juglans regia (English walnut): 108992747Help
Entry
108992747         CDS       T05245                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00450  Selenocompound metabolism
jre00970  Aminoacyl-tRNA biosynthesis
jre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    108992747
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    108992747
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:jre01007]
    108992747
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:jre03016]
    108992747
Enzymes [BR:jre01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     108992747
Amino acid related enzymes [BR:jre01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   108992747
Transfer RNA biogenesis [BR:jre03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    108992747
 Prokaryotic type
   Other AARSs
    108992747
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Viral_protease
Motif
Other DBs
NCBI-GeneID: 108992747
NCBI-ProteinID: XP_018822921
UniProt: A0A2I4EU47
Position
Unknown
AA seq 810 aa AA seqDB search
MGDVSGHAAGDRKVPKLPIEGKRNILITSALPYVNNVPHLGNIIGCVLSADVFARYCRLR
SYNAIYMCGTDEYGTATETKAMEENSTPKEICDKYYAIHKEVYEWFNISFDKFGRTSAPQ
QTEVCQAIFKKLLENNWLSENTMQQLYCDTCKRFLADRLVEGTCPKEGCDYKSARGDQCE
KCSKLLNPTELKDPRCKVCQKTPRIRDTNHLFLELPLLKDRLEEYINKMSVAGSWSQNAI
QATYAWLKEGLKSRCITRDLKWGVPVPHERYSDKVFYVWFDAPIGYVSITSCYTPEWEKW
WKNPENVELYQFMGKDNVPFHTVMFPSTLLGTEENWTLMKTISVTEYLNYEAGKFSKSKG
IGVFGNDAKDTNIPVEVWRYYLLNNRPEVSDTLFTWADLQAKLNSELLNNLGNFINRVLS
FIAKPPGQGYGSVIPKPSDSDPDPLTHEPTKKLVCSIVECVEQYVEAMEKVKLKQGLKTA
MSISNEGNGYLQESQFWKLYKDDQPSCSLVIRTSAGLVYLLACLLEPFMPSFSLEVLKQL
NFPPETPFSLEKGDIDRASRPWDILPAGHKIGTPEPLFKELKDEEVEFFRTKFAGSQADR
IVRAEAEAEKMAEQLKKTKVSESSGKKQQNKKPASEAKGRASAEPEISIARLDIRVGLIT
SAQKHPDADSLYVEEIDVGEGQTRTVVSGLVKYIPLEEMQNRKVCVLCNLKPATMRGIKS
QAMVLAASNSDHTKVELVEPPKSAQVGERVTIPGFDGEPDDVLNPKKKVWETLQVDLHTN
TELVACYKDIPFTTSAGVCTVSSITGGSIR
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgggagatgtttccggccacgccgcaggggatcggaaggtccccaagcttccaatcgaa
ggcaagcggaacatcctcatcaccagcgccttgccttacgtcaacaacgtccctcacctc
ggcaacatcatcggctgtgtgctgagtgctgatgtgtttgcacggtactgccggcttcgc
agctacaatgcaatatacatgtgcggaacagatgagtacgggacggccacagagactaaa
gccatggaagagaatagcaccccaaaagagatttgtgacaaatactatgctatacataag
gaagtctatgagtggttcaatataagttttgataaatttggacgtacttcagccccacag
caaactgaggtttgccaagcaatttttaagaaactgttggagaacaattggctttcagag
aacacaatgcagcagctttactgcgacacatgcaaaaggttcttagctgaccggcttgtg
gagggtacctgcccgaaagaggggtgtgattacaagtctgcacgaggagatcaatgtgaa
aagtgcagtaagcttttgaatccaacagaattaaaagacccgcggtgcaaggtttgtcag
aaaacaccacgcattcgtgacacaaaccacttgtttcttgaactccctttgctgaaggac
agattggaagagtatatcaacaaaatgtcagtggctggatcttggagccagaatgctatt
caagcaacatatgcgtggcttaaagaaggcctgaaatcacgatgtattaccagggatctt
aagtggggggttcctgttccccatgagagatatagtgataaggttttctatgtctggttc
gatgcacctattggatatgtctcaatcacttcttgctacacgcctgagtgggagaagtgg
tggaagaatcctgaaaatgtggagctgtatcagtttatgggcaaggacaatgtgccgttt
cacaccgtgatgtttccatcaacacttcttggaactgaagaaaactggactttaatgaag
accatcagtgtcaccgaatacttgaattatgaagcaggaaaattttctaagagtaaaggt
attggagtttttggcaatgatgcaaaagatacaaacattcctgtagaagtatggagatat
tacttgctgaataataggcctgaggtatccgacacattatttacatgggctgacttgcaa
gcaaaactgaatagcgagttgctaaataacttgggaaactttataaatcgagttttgagt
ttcattgctaaacctccaggtcaaggatatggttctgttatccctaaaccttcagattct
gatccagatccgttaacacatgaacctactaagaaattggtttgtagcatagttgagtgt
gtggagcaatatgttgaggccatggagaaggttaaactaaagcaaggactgaaaactgca
atgagcatttctaatgaggggaatggatatctgcaagaaagccaattttggaagctttac
aaggatgaccaaccttcgtgctctcttgttataagaacttcagcggggctagtatatctt
cttgcatgtttgttagaaccttttatgccatctttttctctcgaggtacttaagcagctc
aattttcctcctgaaactcctttttcacttgaaaaaggagatattgatagggcaagcaga
ccttgggatatcctgcctgctggtcacaaaattgggacaccagagccattgtttaaggaa
ttaaaagatgaagaagtagaattcttcaggacgaagtttgcaggaagtcaagctgatagg
attgtgagggcagaagctgaagcagagaagatggctgagcaactgaagaaaacaaaagtt
tcagagagcagtggcaaaaagcaacagaacaagaaacctgcatctgaagccaaaggtagg
gcctcagctgagccagaaatttccattgcaagacttgacatccgtgttggccttattaca
agtgctcagaagcatcctgatgctgactcactatacgtggaagagattgatgttggtgaa
ggacagacccgtactgttgttagtggactcgtcaagtatatacctcttgaagagatgcag
aatcggaaggtgtgtgttctttgcaacctgaagccagctaccatgcgaggtataaaatca
caagcaatggttcttgctgcatccaacagtgaccacaccaaggttgagttggtcgagcca
cctaaatctgctcaagttggagaaagagttacaataccggggtttgatggtgagcctgat
gatgtcttaaaccctaaaaagaaggtctgggaaacattgcaagtggatctgcatacgaac
acagaactagtggcctgctacaaagatattcctttcaccacatcagctggtgtttgcaca
gtttcatccattaccggtgggtctattaggtag

DBGET integrated database retrieval system