KEGG   Juglans regia (English walnut): 108993364Help
Entry
108993364         CDS       T05245                                 

Definition
(RefSeq) putative beta-glucosidase 41 isoform X1
  KO
K01188  beta-glucosidase [EC:3.2.1.21]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00460  Cyanoamino acid metabolism
jre00500  Starch and sucrose metabolism
jre00940  Phenylpropanoid biosynthesis
jre01100  Metabolic pathways
jre01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    108993364
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    108993364
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    108993364
Enzymes [BR:jre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     108993364
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 108993364
NCBI-ProteinID: XP_018823797
UniProt: A0A2I4EWM7
Position
Unknown
AA seq 511 aa AA seqDB search
MEVSLLFFLLTRFFMTSESVSRLDFPDGFVFGTASSAFQFEGAVKEGNKGVSIWDTFARQ
PGKKFANLEGRILDFSNPEMAVDQYHRFKSDIDLMRDLGMDAYRLSISWSRIFPNGTGEP
NPEGINYYNGFIDALLEKGVQPYVTLYHWDLPQKLEDEYEGWLSTQIVKDFEYFAYTCFQ
AFGDRVKNWITFNEPRGYSIQGYDLGIQAPGRCSLLGHLLCKMGKSSTEPYIVAHNILLS
HAAAYHSYNLHFKERQGGQIGIALDTKWYEPISESDEDKDAARRAIDFGLGWFLDPLIFG
EYPLSMRKLVGGRLPNISSAVSKLLVGSFDFVGINHYTTLYARNDRTRIRKLILQDASSD
TAVIASPYRSGVAIGERAASRWLHIVPWGIRKLARYVKDKYRNPPVIITENGMDDPNKAS
IAIDKALKDNKRIRFHRDYLSNLSAAIRQDNCNVRGYFVWALLDNWEWNLGYSVRFGLYY
VDYKNNLTRIPKDSAQWFKSILREKHDDRSN
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcagccttcttttctttcttctaacccgtttctttatgacctcagaatcagtt
agtaggcttgatttcccagatgggttcgtctttggaactgcttcttcggccttccagttt
gaaggagctgttaaagaaggaaacaagggagttagtatatgggatacttttgcaaggcag
ccgggtaagaaatttgcaaatctggaaggaagaatattagatttcagcaatccagagatg
gcagtcgatcagtatcatcgatttaagagtgacatagacttgatgagggatttgggaatg
gatgcttacagactctcaatatcatggtcaagaatctttccaaatggaacaggagaacct
aatccagaaggaataaactactacaacggcttcatagacgctttattggaaaaaggagtc
cagccttatgtaactctatatcactgggatcttccacagaagctagaagatgaatatgaa
ggatggttgagcacacaaatagtaaaagactttgaatattttgcctatacttgcttccaa
gcttttggagatagagtaaagaactggatcaccttcaacgaacctcgtggttactcaatc
caaggatatgacttgggcattcaagctcctggaagatgttctcttcttggtcatctgttg
tgcaaaatgggaaaatcatccacggaaccatacattgtcgctcacaatatcctcttgtct
catgctgccgcttatcatagttacaacctgcattttaaggaaaggcaaggaggtcaaata
ggaatagcactagataccaaatggtatgaacccatatctgagagtgatgaggataaagat
gcagcacgtagagcaatagattttgggcttggatggttcctcgatccacttatatttggg
gaataccctctttcaatgaggaagcttgtaggtgggagattaccaaacatttcgagtgca
gtctcaaaactcctagtgggatccttcgactttgttggcataaaccactacaccacactg
tatgcccgaaacgacagaactcggattcgaaaattgatactgcaagatgcttcatctgat
actgcagtcattgcatccccataccgaagtggggttgccattggagaaagagcagcttcc
cgttggctacatatagttccatggggcatccgaaagttggcaaggtatgtgaaagataag
tacaggaaccccccagtgattataacagaaaatgggatggatgatccaaataaagcttct
atagctatagacaaagctttaaaggacaacaaaaggataagattccacagggactatctg
tcgaacctgtctgctgctataaggcaagacaactgcaacgtgcgtggttattttgtttgg
gcattgcttgacaactgggaatggaacttaggctatagcgtcaggtttggactctactac
gtcgattacaagaataacctgacaaggattcccaaagattctgctcaatggttcaaaagc
attctccgggaaaaacacgatgatcgaagcaattga

DBGET integrated database retrieval system