KEGG   Juglans regia (English walnut): 108993371Help
Entry
108993371         CDS       T05245                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
jre  Juglans regia (English walnut)
Brite
KEGG Orthology (KO) [BR:jre00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    108993371
Enzymes [BR:jre01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     108993371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 108993371
NCBI-ProteinID: XP_018823803
UniProt: A0A2I4EWN2
Position
Unknown
AA seq 174 aa AA seqDB search
MAASNPKVFFDMAIGGQPVGRVVIELYADTTPRTAENFRALCTGEKGTGRSGKPLHYKGS
SFHRVIPGFMCQGGDFTAGNGTGGESIYGAKFADENFIKKHTGPGILSMANAGPGTNGSQ
FFICTAKTEWLDGKHVVFGKVIEGLDVVKAIEKVGSSSGRTSKPVVVQDCGQLS
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctcaaaccccaaggttttcttcgacatggccatcggcggccaacctgtcggc
cgtgtcgttattgagctctatgccgacaccactcctagaaccgcggagaacttcagggcc
ctttgcaccggtgagaagggtacgggtcgaagtggcaagccccttcactacaagggttcg
tccttccaccgcgtgatcccggggttcatgtgccagggcggtgacttcaccgctgggaac
ggaaccggtggagagtccatctacggcgccaagttcgccgacgagaacttcatcaagaag
cacaccggccccggaatcctatccatggctaatgctgggcccggcaccaatgggtcccag
ttcttcatctgtaccgccaagaccgagtggctcgacggcaagcacgtcgtgttcgggaag
gtgatcgagggtctggatgttgtgaaggcgatcgagaaggttgggtccagctctggaagg
acctcgaagcccgtggtcgttcaggactgtggtcaactctcttag

DBGET integrated database retrieval system