KEGG   Juglans regia (English walnut): 108993413Help
Entry
108993413         CDS       T05245                                 

Definition
(RefSeq) putative amidase C869.01
  KO
K01426  amidase [EC:3.5.1.4]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00330  Arginine and proline metabolism
jre00360  Phenylalanine metabolism
jre00380  Tryptophan metabolism
jre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    108993413
   00360 Phenylalanine metabolism
    108993413
   00380 Tryptophan metabolism
    108993413
Enzymes [BR:jre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     108993413
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 108993413
NCBI-ProteinID: XP_018823873
UniProt: A0A2I4EWV1
Position
Unknown
AA seq 519 aa AA seqDB search
MGTDKSPLCYLSFSLFSALLLILLATLASGAGLQTLKFNGFSFREITVQQIQLGFKRNQF
TSRGLVEFYLKEISRINPVLKGVLEVNPDARSQADKADHERYTKAPISLSPLHGVPILVK
DNIATKDKMNTTAGSYALLGSVVPRDAGVVTKLRKAGAIILGKASLSEWSHFRSGNAPSG
WSGRGDQGKNPYTGDDPCGSSSGSAISVAANMVAVSIGTETDGSILCPSNNNLVVGFKPT
VGLTSRAGVIPISPRQDSVGPICRTVSDAVYVLDVIAGIDYNDKATIETSRYIPKGGYAQ
FLKADGLRGKRLGIVRNPFYLGIGNDTKAIVEKHLNTLRKRGAVLLDNLEIPNHADYGIA
GSVETIALLAEFRIFLNEYLKELVASPVRSLADAIAFNKKNPKLEKLEYGQDFFINAEAT
NGIGKAEKTALAIMESLNREGFVKLMRKNKLDALVTPTTSISRILAIGGFPGVIVPAGFD
SDGHPFGLVFGGLKGSEPKLIEIAYGFEQATKIRKPPKL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgggtactgacaagtcacccctatgctatctaagcttctctctcttctcagccctactc
ctgattcttctagccacactagcatccggggccgggctccaaaccctgaagttcaatggt
ttctccttccgagaaatcaccgtgcagcaaatccagctcggtttcaagcgaaaccaattc
acctccaggggactcgttgagttctaccttaaagaaatcagtagaatcaaccccgtgctt
aagggtgtcttagaggtgaacccagacgcacggtcccaagctgataaggctgaccatgag
cgctatactaaagcacccatttcactctctccgctgcacggtgttcctattcttgtcaaa
gacaacattgcaaccaaggataagatgaacaccacggccggctcgtacgcgttgctcggc
tcggttgtgccacgggacgccggcgtggtgaccaagttgagaaaagctggggctattata
ttggggaaggccagcttgagcgagtggtctcatttcaggtcgggtaatgcacccagtggc
tggagcggcagaggtgaccaagggaagaatccctatacaggggatgatccttgtggatca
agcagtggatcagcaatatccgttgcagcaaatatggtagcagtgtcgatagggaccgag
actgatggctctatattatgtccgtccaacaataacttggtggtgggcttcaaaccgacg
gttggtctcactagtagagcaggagtcataccaatatccccaagacaggacagcgtgggg
cccatttgtaggacagtgtcagatgctgtttatgttcttgatgtcatcgcaggcattgac
tacaatgacaaggcgacaattgaaacatcacgatacattccgaaaggtggctatgcacaa
tttctcaaggctgatgggctccgaggaaagagactggggatagtgagaaatcccttctat
cttgggatcggcaatgataccaaagcaattgttgaaaaacatctcaacactttgaggaag
cgaggtgcagtgctgttagacaatctggaaatacccaatcatgccgactatggcattgcc
gggagcgttgaaaccattgcattgttggcagagttcagaatattcttgaatgaataccta
aaggagctagtggcttccccagtgcggtccttggctgatgcaattgccttcaacaagaaa
aacccaaaattagagaagcttgaatatgggcaagatttttttataaacgcagaagcaaca
aatgggattgggaaagcagagaagactgcattggctattatggaaagtctgaatagagaa
ggtttcgtgaagttgatgagaaagaataagctagacgccttagtgactcctacgactagt
atttctcgtatccttgcaattgggggttttccaggagtaattgtccccgcaggatttgac
tctgatggccatccttttggccttgtttttggaggactaaagggttcggagccaaagctg
attgagatcgcatatggctttgaacaagcgacaaagatccggaagcctcctaaactttaa

DBGET integrated database retrieval system