KEGG   Juglans regia (English walnut): 108995110Help
Entry
108995110         CDS       T05245                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase-like
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00601  Glycosphingolipid biosynthesis - lacto and neolacto series
jre00603  Glycosphingolipid biosynthesis - globo and isoglobo series
jre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    108995110
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    108995110
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:jre01003]
    108995110
Enzymes [BR:jre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     108995110
Glycosyltransferases [BR:jre01003]
 Glycan extension
  P blood group
   108995110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth
Motif
Other DBs
NCBI-GeneID: 108995110
NCBI-ProteinID: XP_018826156
UniProt: A0A2I4F3C8
Position
Unknown
AA seq 446 aa AA seqDB search
MVKKFTRKMFDYQMFILSRAKSRFFSIITLAVLIFIIYTVCIVSEMSHKSVHAFYTDHKK
IEGELGTHEGADQGAILKSSTINPIKLRSIQEEGDDDRVDDDKDHFPVPPFNVSEQERIE
WLRKNIPKFEIFKSNNFTRRFHGRVLEFFNRDSCEAQFFMTWIAPAKWFGEREFLAMESL
FKVHPRGCLMILSRSMDSAQGHMILKPLLDRGLKVKAVTPDLAFLFKGTPAKTWFDGIRS
GKKDPGEISLAQNLSNLLRLAVLFKYGGVYLDTDFIVIKPFTGLKNSIGAQSIDVESRKW
TRLNNAILVFDMNHPLLLKFMEEFAYTFDGNKWGHNGPYLVSRVVERVRKRPGYNFSVLP
PMAFYPADWIRIRRFFQKPKNQNDLRWVKAKLLQLSEETYGVHLWNKQTSRLTIEQGSVL
GRLISDHCVICNKITNIRKSYHISES
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagaaattcacaagaaagatgtttgattaccagatgttcatccttagccgtgcc
aaatcccgattcttctctatcatcacgctcgctgtgttgatctttatcatctacacagtc
tgtatcgtctctgagatgtcccacaagtctgttcatgcgttttatactgatcataagaaa
attgaaggggagctagggactcatgaaggagctgatcaaggagcaatattaaaatcaagt
actatcaatcccataaaattacgttccattcaagaagagggtgatgatgatcgagttgac
gatgataaggatcattttcctgttcctcccttcaatgtctcagaacaggaaaggattgag
tggttgcggaaaaacataccaaagtttgagattttcaagtcaaacaacttcactcgaagg
tttcatggtcgggtcctggagttcttcaaccgtgacagctgcgaggctcagttcttcatg
acatggattgcaccagcaaagtggtttggagaaagagagttcttggctatggagagcctt
ttcaaggtccacccacgtgggtgtttgatgattctgtcaagaagcatggactcagcacaa
gggcacatgattctgaaaccacttctcgaccgggggttgaaagtgaaagctgtgacaccg
gacctggcatttctgttcaaggggaccccagctaaaacttggtttgatgggattaggagt
gggaaaaaagaccctggtgagatctcacttgctcagaatctttctaatttgttgagactt
gcagttttgttcaagtatggaggtgtctacttggacaccgatttcattgttataaaacct
tttactgggttgaagaactcaattggagcacagagtattgacgtggagtctaggaaatgg
acaaggttgaataatgcgattttggtgtttgatatgaatcatccattactgctcaaattc
atggaggaatttgcatacacttttgatgggaataaatggggtcacaatggtccctatttg
gtttccagggtggttgagagagtaagaaagagacctggttataatttcagtgtcttgccc
cctatggccttctatcctgcagattggattaggataagaaggttttttcaaaagccaaaa
aaccagaatgatttgagatgggtaaaagccaagctgcttcagctaagtgaggagacttat
ggagtacacctatggaacaagcaaacaagcagattaacaatcgaacagggaagcgtcctt
ggaagattaatctcagatcactgtgtcatttgcaacaagatcactaatatcagaaaatcc
taccacatatcagaatcctaa

DBGET integrated database retrieval system