KEGG   Juglans regia (English walnut): 108995964Help
Entry
108995964         CDS       T05245                                 

Definition
(RefSeq) 9-cis-epoxycarotenoid dioxygenase NCED1, chloroplastic-like
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00906  Carotenoid biosynthesis
jre01100  Metabolic pathways
jre01110  Biosynthesis of secondary metabolites
Module
jre_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    108995964
Enzymes [BR:jre01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     108995964
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65 Vac17
Motif
Other DBs
NCBI-GeneID: 108995964
NCBI-ProteinID: XP_018827198
UniProt: A0A2I4F6D0
Position
Unknown
AA seq 613 aa AA seqDB search
MASPSAATISSCISFKHRFGSSSTLSSFLELGSPSTTVSLMRPTNRPNVSCSLQTLQFPK
QRLPSNDIATPNIAHPKDAANSSPPPPPSSTANKSVPHQWNLLQKTATMALDAVETALVS
HERQHPLPNTADPRVQIVGNFAPVTEQPVQHSLPVSGKIPCCVQGVYIRNGANPLHEPVS
GHHFFDGDGMVHAVQFKDGSASYACRFTETHRLVQERALGRPVFPKAIGELHGHSGIARL
LLFYARGLFGLVDSSHGMGVANAGLVYFNGRLLAMSEDDLPYQVQVTPTGDLKTVGRYDF
NGQLRSTMIAHPKLDPITGELFALSYDVVRKPYLKYFHFSPQGKKSPDVEIPLAQPTMMH
DFAITENFVVIPDQQVVFKLPELIHGGSPVIYDKSKMSRFGILDRNATDASGIKWIETPD
CFCFHLWNAWEEPETNEVIVIGSCMTPPDSIFNESDESLKSVLSEIRLNLKTGKSTRRPI
TSDSEQVNLEAGMVNRNMLGRKTRFAYLALAEPWPKVSGFAKVDLLTGKLRKYMYGDKRY
GGEPLFLPRSPNSEKEDDGYILAFVHDEKEWKSELRIVNAMNLKLEATVKLPSRVPYGFH
GTFINSKDLERQA
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaccttcagcagcaacaatatcttcatgcatatcttttaagcatagatttggt
tcttcttctaccctttcatcattccttgagttgggctctccttcaaccaccgtctccttg
atgaggcccaccaataggcccaacgtaagttgctctcttcaaacactacaatttcccaag
cagcgtttaccttcgaatgatattgccactcccaacattgcccatccaaaagatgcagct
aactcttctcctcctcctcctccatcttcgacagccaataagtctgtgccccatcaatgg
aacctcttacagaaaactgcgaccatggccttggacgccgtagagactgctttagtctcg
catgagcgccaacacccacttcccaataccgccgatcccagagtccaaattgtcggcaat
ttcgctccagtaacagagcagcccgtccagcactcgttaccggtttcaggcaaaattccc
tgttgcgtacagggcgtgtatatccggaacggtgcgaacccacttcacgaaccagtctct
ggtcaccatttcttcgatggagatggtatggtccatgctgttcagttcaaggatggctcc
gctagctatgcctgtaggttcaccgagacgcaccggctcgttcaggagcgagctcttggt
cgccctgttttccctaaggccataggtgagcttcacggccactcaggcatcgcccggctc
ctcctattctatgctcgaggactattcggcctcgttgattccagccacggcatgggagtc
gcaaacgctggccttgtctacttcaacggtcgcctccttgccatgtccgaagacgattta
ccataccaagtccaagttactcccactggcgatcttaagactgttggccgctatgatttc
aatggtcagctccgctcaacaatgattgctcacccaaaactcgaccccatcaccggagag
ctcttcgctcttagctacgatgttgtccgaaaaccatacctcaagtacttccacttctct
ccacaagggaaaaaatcccctgacgttgaaattcctctagctcagcctacaatgatgcat
gactttgcaattacagagaactttgtggtaatcccggatcagcaggtggtgttcaaactc
ccggagttgattcatggtggttctccagtcatttacgacaagagcaagatgtccaggttc
gggatattggacaggaatgccactgatgcttctggtatcaaatggattgaaacccctgat
tgtttctgtttccacctctggaatgcctgggaagaacccgagaccaatgaggtcatagta
attggctcttgcatgactcctcccgactcgattttcaacgagagtgacgagagcttaaaa
agcgtgctatctgagattcggcttaacttgaagacaggaaaatccacgcgccgtcccatt
acgtccgactctgaacaagtgaacttggaggccggtatggtgaaccgaaacatgctcggg
aggaaaacccggttcgcatatttagcccttgctgagccgtggcccaaagtatctggtttt
gcaaaagtggacctcttaacaggaaaactaagaaagtacatgtatggcgacaagaggtac
ggtggcgagcctctgttccttccccgaagccccaattctgagaaagaagacgatggctac
atcctggccttcgtccacgacgaaaaggagtggaaatcagagctgcgaatcgtgaacgcc
atgaatttgaagttggaagccacggttaagcttccgtcccgggttccctatggcttccac
ggaaccttcataaattcaaaggacttggagaggcaggcgtaa

DBGET integrated database retrieval system