KEGG   Juglans regia (English walnut): 108996018Help
Entry
108996018         CDS       T05245                                 

Definition
(RefSeq) cytochrome P450 94A2-like
  KO
K20769  fatty acid omega-hydroxylase [EC:1.14.-.-]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00073  Cutin, suberine and wax biosynthesis
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    108996018
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:jre00199]
    108996018
Enzymes [BR:jre01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-  Acting on paired donors, with incorporation or reduction of molecular oxygen
    1.14.-.-  
     108996018
Cytochrome P450 [BR:jre00199]
 Cytochrome P450, plant type
  CYP94 family
   108996018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 108996018
NCBI-ProteinID: XP_018827283
UniProt: A0A2I4F6L8
Position
Unknown
AA seq 516 aa AA seqDB search
MESLQFLAFVSLTVLLPLLSFFFLTRTSKPQKQSPPSPSTITTQLPKSYPLIGSFFAVYA
NRKRRMQWMTDVLKSSPSATIVLRRSFVGDEVITANPAVVQHILKTEFHNYVKGGNSHRN
LKDFLGSGIFNVDGESWKFQRQVSSHEFNTNSLRKFVETEVDTELSDRLIPILSSAAAKT
GTVLDFQDILQRFAFDNICKIAFGFDPAYLLPSLPKAKFAEAFEESVKISTERFISLIPL
VWKIKKLLNIGSEKRLRIAVSEVREFATKIIREKKHELGEKSLDSVDLLSRFLSSGHSDE
NFVTDIVISFILAGRDTTSSALTWYFWLLSKNPRVEAEVLKEIREKSESPIYDEVKDMVY
THASLCESMRLYPPVSVDQKEAAIDDILPDGTVVKKGMRVTYHQYAMGRMETLWGSDWAE
FKPERWLEKSEEEEKHWRFVGRDAYTYTVFHAGPRICLGKEMAFLQMKRLVAGILRRFKV
VPVMEEGFEPEFVPYLTSKMKGGLPVKIVEREDAKE
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgctccaattcctggcctttgtttctctgactgttcttcttcccttgctttca
tttttcttcctcaccagaacatcaaaaccccaaaaacaatctccaccttcccccagtacc
attactacccagctcccaaaatcctaccctttaatcggttctttctttgcagtgtacgcc
aaccggaaacgacgtatgcaatggatgactgacgttctgaaaagctcaccctccgccacc
attgttctccgccgatccttcgtcggcgacgaggtcatcacggccaaccctgccgtcgtc
cagcatatcctcaagaccgaatttcataactacgtcaagggaggcaattctcaccgtaac
ctcaaagactttctcggctccggcatcttcaacgtggacggggagtcctggaagtttcag
agacaagtctccagccatgagttcaacaccaattctctacgtaagttcgtcgagaccgaa
gtcgacaccgaactctctgaccgcctcatccccatcctatcctcggctgccgccaaaacc
ggaactgtcctagacttccaggatattcttcagcggttcgccttcgacaatatatgcaaa
atcgctttcgggttcgatcctgcctacttgttgccctctcttccaaaagccaagttcgcg
gaagcttttgaggaaagcgtcaagatcagcaccgagaggttcatttcgttaatccccctc
gtctggaaaatcaagaagctgttaaatattgggtccgagaaacgtctgagaatcgcagta
tcagaagttcgagaattcgccacaaagattataagagaaaagaagcacgagctcggcgag
aagtcgctcgactccgtcgacctcttgtcaagattcttgagctccggccattcggacgag
aacttcgtgacggacatagtgataagcttcatacttgccgggcgtgacactacctcgtcg
gctttgacatggtatttctggctactttccaagaacccacgtgttgaggctgaggttctg
aaggaaatcagagaaaaatccgaatctcctatttatgatgaagtcaaagacatggtgtac
acccacgcttctttgtgcgaaagcatgcggctatacccgcccgtctctgtagaccagaag
gaggccgccatcgacgacatattgccggacgggacggtggtgaagaagggaatgagagtg
acgtaccatcaatacgccatgggaaggatggagacgctgtggggttcggactgggcagag
tttaagccggagcgatggctggagaagagcgaggaggaggagaagcattggaggttcgta
gggagggacgcatacacatacacagtgttccatgcgggaccgaggatttgtttggggaag
gagatggcattcctgcagatgaagaggttggttgcggggattctaaggaggttcaaggtg
gtgccggtaatggaagaaggatttgagccggagtttgtaccgtacttgacttccaaaatg
aaaggtgggcttccggtgaagattgttgagagggaagatgcgaaagagtga

DBGET integrated database retrieval system