KEGG   Juglans regia (English walnut): 108998060Help
Entry
108998060         CDS       T05245                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
jre  Juglans regia (English walnut)
Pathway
jre03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:jre00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108998060
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:jre03041]
    108998060
Enzymes [BR:jre01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     108998060
Spliceosome [BR:jre03041]
 Complex C
  Other components
   Step II factors
    108998060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 AAA_19 AAA_30 T2SSE ABC_tran Flavi_DEAD Sigma54_activ_2 AAA AAA_14 PhoH AAA_16
Motif
Other DBs
NCBI-GeneID: 108998060
NCBI-ProteinID: XP_018830037
UniProt: A0A2I4FEG1
Position
Unknown
AA seq 1214 aa AA seqDB search
MAPTSKDDGLKKLEYFSLVSKVCSELETHLGFGDKVLAEFITELGRNCETVDEFDAKLKE
NGAEMPDYFVRTLLTIIHAILPPKQNSDKESKNESASDGTKAKYSALAIADDRKRAKDIE
REIELEARERRRDWEEREEENRPRRRDRDRDRDRDRDRDRDRDRDGDGERDRDRDRDRDR
RDRRRDRHDRDERHRDRDIDGDEDGRRDYRSRERHRDRHEKHGRNDEELVNNRDNGENED
YPRGGKDRSNGQYKSDEPELYKVYKGRVSRVMDSGCFVQLTDLKGKEGLVHVSQIATRRI
ANAKDVVKRDQEVYVKLISVSGQKLSLSMRDVDQNTGKDLLPLKKSSMDDTNRTNPSSGS
KEGPATRMGLSGIRIFEEEDVVPSRRPLKRMSSPEIWEAKQLIASGVLSVTDYPTYDEEG
DGVLYQEEGAEEELEIELNEDEPAFLQGQSRYSMDMSPVKIFKNPEGSLGRAAALQSALI
KERREVREQQQRTMLDSIPKDLNRPWEDPMPDMGERHLAQELRGVGLSAYDMPEWKKDAY
GKSISFGQRSKLSIQEQRQSLPIYKLKKELVQAVHDNQVLVVIGETGSGKTTQVTQYLAE
AGYTTRGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFEDCTSPDTVIKYMTDG
MLLREILIDENLSQYSVIMLDEAHERTIHTDVLFGLLKQLVKRRPDLRLIVTSATLDAEK
FSGYFFNCNIFTIPGRTFPVEILYTKQPESDYLDAALITVLQIHLMEPEGDILLFLTGQE
EIDFACQSLYERMKGLGENVPELIILPVYSALPSEMQSRIFEPAPPGKRKVVVATNIAEA
SLTIDGIFYVIDPGFAKQNVYNPKQGLDSLIITPISQASAKQRAGRAGRTGPGKCYRLYT
ESAYRNEMSPTSIPEIQRINLGFTTLNMKAMGINDLLSFDFMDPPSPQALISAMEQLYSL
GALDEEGLLTKLGRKMAEFPLEPPLSKMLLASVDLGCSDEILTIIAMIQTGNIFYRPREK
QAQADQKRAKFFQPEGDHLTLLTVYDAWKNNNFSGPWCFENFVQSRSLRRAQDVRKQLLT
IMDKYKLDVMSAGRNFTKIRKAITAGFFFHAARKDPQEGYRTLVENQPVYIHPSSALFQR
QPDWVIYNELVMTTKEYMREVTVIDPKWLVELAPRFFKVVDPTKMSKRKRQERIEPLYDR
YHEPNSWRLSKRRA
NT seq 3645 nt NT seq  +upstreamnt  +downstreamnt
atggcccccacttccaaagacgacggcttgaagaagctcgaatacttctcgctcgtctcc
aaggtctgctcggaacttgaaacgcatctagggttcggggacaaagttctcgccgaattc
atcacggaattgggccgcaactgtgagaccgtcgatgagttcgatgcgaaactaaaggaa
aacggcgccgagatgcccgattactttgtccgtacacttctgacgataatacacgcaatt
cttcctccaaagcagaattccgacaaggagtcgaagaatgagagcgcttcggatggtacg
aaggccaagtattcggcgctggcgattgcggatgatagaaagagagctaaggacatcgag
agagaaatcgaattggaggcacgggagcgacgtagagactgggaagaacgcgaagaagaa
aatagacctcgaaggagagatagggacagagacagagacagggacagggacagagaccga
gaccgagaccgagacggagacggagagcgagacagagacagagacagagacagagacaga
agagataggcgcagggatagacatgatagagatgagaggcatagagacagagatatcgat
ggtgatgaggatggtagaagggattataggagtagggaaaggcacagggatcgacacgag
aagcatgggagaaatgatgaggaattggttaataatagagataatggtgaaaatgaagat
tatccgagaggaggcaaagatcgttcaaatgggcagtataaatccgatgagcccgaattg
tataaggtttacaagggtagggtctcaagggtgatggactcgggctgcttcgtgcaattg
actgatttgaaggggaaggagggtttggttcacgtttcacagattgcaacacggcggatt
gctaatgccaaggatgtggtgaaacgggatcaggaagtttatgtgaagctgatttcggtg
tcaggtcagaaactgagtctttcgatgagggatgtcgatcagaatactggcaaggatttg
cttccgttgaagaagagctcaatggacgatacgaataggacgaatccgtctagcgggtcg
aaggaggggccagcaactaggatgggtctttcagggattaggatttttgaggaggaagat
gtagtcccatcacgtagaccattaaagaggatgagttcaccggaaatatgggaagcaaag
caattgattgcttctggtgttttgagtgttaccgattatcccacatatgatgaggaagga
gatggagtgctatatcaagaagagggtgctgaggaggagcttgagattgaactgaacgag
gatgagcccgcattcttgcaagggcagagccggtattcaatggatatgtcacctgttaag
attttcaagaacccagaagggtctttgggtcgtgcagctgcacttcagtctgcgctgata
aaggagcggagagaagtaagagaacagcaacagcgaactatgctcgattctattccaaag
gatctcaatcgtccatgggaagacccaatgccagatatgggtgagaggcatctagcacag
gagctcaggggtgttggtttatcggcatatgacatgcctgaatggaagaaggatgcttat
ggaaaatccatcagttttgggcagaggtcaaagctctccattcaggaacaaaggcagagc
ttgccaatctacaaattaaagaaggaactcgttcaggctgtgcatgacaaccaggtctta
gttgttattggtgagactggttcgggtaagacaactcaggtaactcaatatcttgcagaa
gctggatatacaactaggggaaaaattggttgtactcagccccgtagggtggctgccatg
tctgtggcaaagagggttgctgaagagtttggttgtcgattgggggaggaagttgggtat
gctattcgattcgaggattgtaccagtccagataccgtcatcaagtatatgacggacggc
atgcttctgagggaaattctgattgatgagaacctttctcagtactctgttattatgctt
gacgaagctcatgagagaacaatacacactgatgttctttttggattactaaagcaacta
gtaaaaaggagacctgaccttcgcttgattgtcacttctgccacactggatgcggagaag
ttttcagggtatttcttcaactgtaatatatttacaattcctggtagaacttttcctgtg
gagatactctacaccaaacaaccagaaagtgattatctagatgcagctctaattaccgtg
ctacaaatccacttgatggaacctgaaggagacatccttctcttcttgactggccaggag
gagattgattttgcctgccaatctctttatgagaggatgaaaggtctaggtgaaaatgtt
ccagaattgattattctaccggtatatagtgcacttcctagtgaaatgcagtcgaggata
tttgaacctgcccctccaggtaagagaaaagtggttgtggctaccaatattgccgaggca
tctttgaccatcgatgggattttttacgtaatcgatcctgggtttgcgaagcaaaatgtg
tataatcctaaacaagggcttgattcactgattataactcctatatcacaagcatcagca
aagcaacgagctgggcgtgccgggcgtacaggacctgggaaatgttaccgcctctacact
gagagtgcataccgcaatgagatgtccccaacctcaattcctgaaatccagaggataaat
cttgggtttactacgcttaatatgaaagctatggggataaatgatcttctgtcttttgat
ttcatggatccgccttcaccccaggcgctcatttctgctatggaacagctgtacagtcta
ggagctcttgatgaggagggtcttctgaccaaattgggccggaaaatggcagagtttcca
cttgaaccgccattatctaagatgctactggccagtgtggaccttggatgcagtgatgag
attttgacaatcattgcaatgattcaaactggcaatatcttctacaggcctagggagaaa
caagcccaagcagaccagaagagggccaagtttttccagccagagggagaccatctgacg
ttacttacggtttacgatgcttggaaaaataataacttttctgggccatggtgctttgag
aactttgtgcagtctagatctttgaggagggcacaggatgtaaggaaacagctgctcacc
atcatggacaaatataaattggacgtcatgagtgcaggaaggaattttacaaagatcagg
aaggcaattactgctggattctttttccatgctgctagaaaagacccacaggagggctat
aggaccctagttgagaaccagccagtttatatccatcctagcagtgctcttttccagaga
caacctgactgggtcatctacaatgagctcgtgatgactacaaaagagtacatgcgagag
gtcacagttatagatcctaaatggctcgtggaactggcaccaagattcttcaaagtggta
gatcctacaaagatgagcaagcgcaaacgacaagaaagaatcgaaccgctttatgacaga
tatcatgagcctaattcttggcgtctgagtaaacgccgtgcttga

DBGET integrated database retrieval system