KEGG   Juglans regia (English walnut): 108998386Help
Entry
108998386         CDS       T05245                                 

Definition
(RefSeq) putative receptor protein kinase ZmPK1
Organism
jre  Juglans regia (English walnut)
Brite
Enzymes [BR:jre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108998386
Protein kinases [BR:jre01001]
 Serine/threonine kinases: TKL group
  IRAK family
   108998386
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr YukC APH
Motif
Other DBs
NCBI-GeneID: 108998386
NCBI-ProteinID: XP_018830476
UniProt: A0A2I4FFQ5
Position
Unknown
AA seq 217 aa AA seqDB search
MAEEFLQVLGTFEEPPKWFDIATGTAKGLAYLHEECLEWVLHCDVKPQNILLDSNYQPKV
ADFGLSKLQNRNLENASFSRIRGTRGYMAPEWVFNLPITSKVDVYSYGIVVLEMVTGKGP
TKGVHAIDSGGETEPKRLVAWVREKRNEATAMASWVEEIVDPILKGSYEKGKMETLINVA
LQCVEEEKDARPSMSQVAEMLLRQENDSHNDDHGINL
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggagtttctgcaagtcttgggaacatttgaggaacctcctaaatggtttgac
attgccacaggcacagcaaaaggcctagcttatctgcatgaagagtgcttggagtgggtt
ttacactgtgatgtaaagccacagaacatactccttgactctaactatcaaccaaaggtg
gcagattttgggttgtctaagttacaaaatagaaacctcgagaatgcaagcttctcaaga
ataagaggaacccgagggtacatggctccagagtgggttttcaatcttcctatcacctcc
aaagtggatgtttatagctacggaattgttgtattggagatggtgacggggaagggacca
acaaagggtgtccatgctatagatagtggaggggagacagaacccaaacggttggttgct
tgggtgagggaaaaaaggaatgaagcgactgcaatggcttcctgggttgaggagatcgtt
gacccaatactgaaaggcagttacgaaaagggtaagatggaaactctgataaatgttgct
ttgcaatgtgtagaggaagagaaagacgcaagacccagcatgagccaagtagctgagatg
cttttacgccaagaaaatgatagtcacaatgatgatcatggtattaatctctaa

DBGET integrated database retrieval system