KEGG   Juglans regia (English walnut): 108998580Help
Entry
108998580         CDS       T05245                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: tripeptidyl-peptidase 2-like
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
jre  Juglans regia (English walnut)
Brite
KEGG Orthology (KO) [BR:jre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:jre01002]
    108998580
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:jre03110]
    108998580
Enzymes [BR:jre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     108998580
Peptidases and inhibitors [BR:jre01002]
 Serine peptidases
  Family S8: subtilisin family
   108998580
Chaperones and folding catalysts [BR:jre03110]
 Intramolecular chaperones
  Subtilisin family
   108998580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII Prp19
Motif
Other DBs
NCBI-GeneID: 108998580
NCBI-ProteinID: XP_018830702
UniProt: A0A2I4FGD9
Position
Unknown
AA seq 1369 aa AA seqDB search
MQNSLLFRLPVLPSTSPRSLSSPPFLSVIVRRVSRGRRRPRKVEWSWIGSRVRAMPCSSF
GDSGSDDNGRLRCFKLTESTFLASLMPKKEIAADRFIEAHPEYDGRGVLIAIFDTGVDPA
AAGLQVTSDGKPKILDVLDCTGSGDVDTSKVVKADADGCIRGASGTTLVVNSSWKNPSGE
WHVGYKLVYELFTDTLTSRLKKERKKKWDEKNQEEIAKAVKHLDEFDQKHTKVEDTNLKR
AREDLQNRIDVLRKQAESFDDEGPVIDAVVWHDGEAWRAALDTQNLEDDLDSGKLANFIP
LTNYRAERKFGVFSKLDACSFVANVYDEGKILSIVTDCSPHGTHVAGIATAFHPKEPLLN
GIAPGAQLISCKIGDTRLGSMETGTGLTRALIAAVEHKCDLINMSYGEATLLPDYGRFVD
LVNEVVNKHRMIFVSSAGNSGPALSTVGAPGGTTSSIIGVGAYVSPAMASAAHCVVEPPS
EGLEYTWSSRGPTADGDLGVCISAPGGAVAPVPTWTLQRRMLMNGTSMASPAACGGIALL
LSAMKAEGIPVSPYIVRKAFENTAVSVGSLPEDKLTTGQGLMQVDKAHEYIQKSRDVPCV
WYQIKINQSGKSTPTYRGIYLREASACQQSTEWTVQIEPKFHEDASNLEELVPFEECIEL
HSSEKAVVRAPEYLLLTYNGRSFNVVVDPTNLSEGLHYFELYGVDCKAPWRGPLFRIPVT
ITKPMAVVNRPPVVSFSRMPFQPGQIERKYIEVPLGASWAEATIQTSGFDTTRRFFVDAV
QICPLQRPKKWESVVTFSSPAAKSFAFAVVGGQTMELAIAQFWSSGIGSHEITVVEFEVV
FHGININKEEVVLDGSEAPTRIDAEAILAAEKLSPAALLNKIRTPYRPIESKLSALATDR
DKLPSGKQILTLTLNYKFKLEDAAEVKPQIPLLNYRIYDTKFESQFYMISDTNNRVYAVG
DVYPNASKLPGGEYNLQLYLRHDSMQYLEKLKQLVLFIERNLEEKDVIRLSFFSQPDGPV
MGNGSFKSSVLVPGKKEAIYLGPPSKDKLPKCCPQGSVLLGAISYGKLSFAGREGKKNPQ
KNPASYQLSYVVPPNKLDEDKRKGSSSTCTKTVLERLEEEVRDAKIKVLSSLKQDNDDEH
LEWKKLSSSLKCEYPKYTPLLAKILESLLSHGNVEDKICHDQEVIDAANDVIDSIDKDEV
AKFFSLRSDPEDEEAEKIKKKMEMTRDQLAEALYQKGLALADIESLEGENASGLVSSDAK
DVDKTRDPPQSDSGIPPDLFEENFKELKKWVDVKSSKYGTLLVLHERRSGRLGTALKVLN
DIIQEAGDPPKKKLYELKLSLLDEIGWSHLAAYERQWMYVRFPASLPLF
NT seq 4110 nt NT seq  +upstreamnt  +downstreamnt
atgcagaactccttgttatttagactccccgttttaccctctacttcacctcgttcgctc
tcctccccaccatttctgtctgtcattgttaggagagtcagcagaggtagaagaagacca
agaaaggtagagtggagttggattgggagtagggtgagggccatgccttgctcttctttc
ggagactccggcagtgacgacaatggccgtctgcgttgtttcaagctgactgagtccact
ttcctggcctccctcatgcccaagaaagagattgccgccgaccgcttcatcgaggctcac
ccggaatacgacggccgtggagtcctcatcgctatcttcgatactggtgttgacccggct
gctgctggcttgcaagttacctcggatgggaagccgaaaatactagatgtccttgattgc
accgggagtggagatgttgatacctcaaaggtggtgaaagccgatgcggacggttgtatt
cgtggagcttcagggacgactctggttgtcaattcttcatggaaaaatccttctggtgaa
tggcatgtgggttataagttggtgtatgagctatttacggacactttgacctctcgcttg
aaaaaagaaagaaagaaaaagtgggatgaaaagaaccaggaagaaattgctaaggctgtt
aagcatcttgatgaattcgatcagaaacacactaaagtggaagatacaaacctgaaaagg
gcccgcgaagacctccaaaacagaattgatgttctacgaaagcaagcagaaagctttgat
gacgaggggcctgtcattgatgccgtcgtgtggcatgacggagaagcatggagagctgct
cttgacacacagaatcttgaggatgacctggattctgggaaacttgctaactttatcccc
ctgactaattatagggctgaacggaagtttggtgtctttagcaaattagatgcctgttca
tttgttgctaatgtgtacgatgaagggaaaattttaagtattgtaacggattgctcccct
catggcactcatgtcgctggtattgccactgctttccacccaaaggagcctttgttgaat
gggattgcacctggagcacagttaatatcttgtaaaattggagatacacggttgggttca
atggagacaggcaccggcttgactagggctttgatagctgcagtggagcacaagtgcgat
ctcatcaacatgagttatggagaagctacattattgccggactatggtcgatttgttgac
cttgttaatgaagtggtgaataaacatcggatgatttttgtgagtagtgctggcaatagt
gggccagcattgagcactgttggtgcacctggtggtaccacctcaagcataataggagtt
ggtgcttatgtctctcctgcaatggcttctgcggctcattgtgtggttgaacctcccagt
gaagggcttgaatacacttggtccagtcggggaccaacggctgatggagatcttggcgtc
tgtataagtgctcctggtggggctgttgctcctgttcctacatggactcttcaaagacga
atgctgatgaatggaacgtcaatggcgtctccggctgcctgtgggggaattgcattactc
ttaagtgcgatgaaggctgagggcattcctgtgagcccctatatagtgagaaaggctttt
gagaatacagctgtttctgtcggtagtttgcccgaagataaattaaccactggacaaggg
cttatgcaagttgacaaggcacatgaatatatacagaagtctcgggatgttccatgtgta
tggtatcaaataaagattaaccaatctggaaaatcaactcctacatatcgaggcatttac
ctaagggaggctagtgcttgccaacaatccactgagtggacagtgcaaattgagccgaaa
tttcatgaagatgcaagtaatttagaagaattggttccttttgaggagtgtattgagttg
cattccagtgaaaaggcagttgtgagggctcctgagtatctccttcttacttacaatggg
cgtagcttcaatgtagttgtggatccaaccaatcttagtgagggtcttcactactttgaa
ctgtatggggttgattgcaaagcaccctggcgtggtcctctgttcagaatcccggttact
atcacaaagcctatggctgtagtgaatcggccacctgttgtttcattttcaaggatgcca
tttcagccaggccaaatagagaggaaatatatagaagtgccacttggtgctagttgggct
gaagccacaatacaaacatcaggatttgatacaacacgaagattctttgttgacgctgtt
cagatttgtcccttacaaaggcctaaaaagtgggagagtgtcgtaactttttcttctcct
gctgccaaaagctttgcctttgctgttgtgggtggtcagacaatggaattagctatagct
cagttttggtcaagtggcataggaagtcatgaaatcactgttgttgaatttgaggtcgtg
tttcatgggataaacatcaataaagaggaagtagtacttgatggcagtgaagcacctacc
agaattgatgctgaagctatactggccgctgagaaactgtcacctgctgctcttctaaac
aagataagaactccatatcgtcctattgagtctaaacttagcgctcttgcaacggatcgt
gacaaattgccctcaggcaaacagattctaacactgactttaaattacaagttcaaattg
gaagatgcagctgaagtaaaacctcaaataccattactaaactaccgcatatatgacaca
aaatttgagtctcagttttatatgatttctgacacaaacaatcgtgtatatgcagtgggt
gatgtctatccaaatgcttcaaaacttcctgggggagaatataatctacaactatatcta
aggcatgacagtatgcagtatctggaaaaactgaagcaattggtattgttcatcgaaaga
aatttggaagagaaggatgtcatccgattgagctttttctcccagccagatggccctgtt
atgggaaatggtagctttaaatcctcagttttagttccaggaaaaaaagaagcaatttat
ttgggtccaccatccaaagacaagctccctaagtgttgtccacaagggtctgtattgcta
ggagcaatctcatatggaaagctatcgtttgctggtcgagaagggaagaaaaatccccaa
aagaaccctgcatcatatcagctttcttatgtagtgccaccaaataagcttgatgaggac
aagagaaaaggttcttcatcaacttgcactaagactgttttggaacgtttggaagaagag
gttcgagatgcgaagattaaagttctttcaagcctcaagcaagacaatgatgatgaacat
ttggaatggaaaaagttatcttcctctcttaagtgtgaatatccaaaatacactccgttg
cttgcaaagattttggaaagcttgctttctcatggtaatgttgaggacaaaatctgccat
gatcaagaggttattgatgctgcaaatgacgtgattgatagtattgacaaagatgaggtg
gcaaaatttttctcgctcagaagtgaccctgaagatgaggaggcagagaaaatcaagaag
aagatggagatgacccgtgatcaattagcagaggcactgtaccaaaaaggattggctctg
gcagatattgaatccctagagggtgagaatgcgtcaggtttggtttcatctgatgcaaaa
gatgtggacaagactcgcgatccacctcaatcagactctggtattccgccagatttgttt
gaagagaacttcaaagaattgaagaaatgggttgatgtgaagtcttctaagtatggcacc
ctcctagtgctacacgagagacgtagtggaaggcttggaacagcattgaaggtattgaat
gacataattcaagaagccggggatcctccaaagaagaagctctatgaactaaagctctct
ttacttgatgagattggatggagtcatttggcagcatatgaaaggcaatggatgtatgtg
cgctttccggccagcttgccacttttttaa

DBGET integrated database retrieval system