KEGG   Juglans regia (English walnut): 108998998Help
Entry
108998998         CDS       T05245                                 

Definition
(RefSeq) heat shock 70 kDa protein 18-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
jre  Juglans regia (English walnut)
Pathway
jre03040  Spliceosome
jre04141  Protein processing in endoplasmic reticulum
jre04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:jre00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108998998
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108998998
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108998998
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:jre01009]
    108998998
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:jre03041]
    108998998
   03009 Ribosome biogenesis [BR:jre03009]
    108998998
   03110 Chaperones and folding catalysts [BR:jre03110]
    108998998
   04131 Membrane trafficking [BR:jre04131]
    108998998
   03051 Proteasome [BR:jre03051]
    108998998
   03029 Mitochondrial biogenesis [BR:jre03029]
    108998998
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:jre04147]
    108998998
Protein phosphatases and associated proteins [BR:jre01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     108998998
Spliceosome [BR:jre03041]
 Complex B
  Other components
   Prp19 complex
    108998998
 Complex C
   Prp19-CDC5 complex
    108998998
Ribosome biogenesis [BR:jre03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    108998998
Chaperones and folding catalysts [BR:jre03110]
 Heat shock proteins
  HSP70 / DNAK
   108998998
Membrane trafficking [BR:jre04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    108998998
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    108998998
Proteasome [BR:jre03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    108998998
Mitochondrial biogenesis [BR:jre03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    108998998
Exosome [BR:jre04147]
 Exosomal proteins
  Proteins found in most exosomes
   108998998
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl RVT_3 Dimer_Tnp_hAT FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 108998998
NCBI-ProteinID: XP_018831321
UniProt: A0A2I4FI48
Position
Unknown
AA seq 767 aa AA seqDB search
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDTERLIGDAAKN
QVAMNPINTVFDAKRLIGRRFSDATVQGDMKLWPFKVIPGPGDKPMIVVNYKGEEKQFAA
EEISSMVLMKMREIAEAYLGSTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKNKKDINGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGVDFY
STITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSTVHDVVLVGGSTRIPKVQQLLQDFF
NGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETINKILTITV
DNASSNDIAVDYMRRRIKDSDCTILGGEFLHMRCAAHILNLIVMDGLREVYEFVTRIRDA
VRYVKSSPSRFAKFKACACKGDELADRIEAKVKLLLRRLIEQYNKFRVDSGGSSNVVQGR
PSTTSTSTTMSTKFDIRLEKFLLEQGFMEFRSELDRYLSEGCAQKSPSFDILDWWRVNAT
NYPVLAEWKRNRFIFDGSFAHPNAIVKDARRTMDMLNEERSWQVSVQHCNSVETWQAPPS
DWIKVNWDSAVDKTEGLIGVGVVARDNAGHTIASKRTKKHLFPDPALAEAYGALIAVQFG
LELGLSQVIIEGDSLQVINALKREEEGFNSASMFVEEAKHLLKFFAK
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaaaggagaaggcccagcaatcgggattgatctcggaaccacgtactcgtgc
gtgggagtttggcaacacgaccgcgtagagatcatcgccaatgaccagggtaacagaaca
acgccgtcctacgttggcttcaccgatacggagcgtttgatcggtgatgcggccaagaac
caggtcgccatgaaccccatcaacaccgtcttcgatgcaaagaggttaattggccggaga
tttagtgatgccacagttcagggtgacatgaaattgtggccattcaaggtcattcccggc
cccggagacaagccgatgattgtggtcaactacaagggtgaggagaagcaatttgctgct
gaagaaatctcttccatggttcttatgaagatgcgcgagattgcagaggcttaccttggt
tcgacaataaagaacgctgtggtcactgtacccgcatacttcaatgattctcagcgtcag
gctacaaaggacgctggtgtcattgcaggtctcaatgttatgcgtatcattaatgagccc
actgctgctgccattgcttacggtcttgacaagaaggcaaccagtgttggcgagaaaaat
gtcttgatttttgatcttggtggcggcacgtttgatgtctctcttctcactattgaagag
ggtatctttgaggtgaaggctacagctggtgacacccatcttggtggcgaggattttgat
aatagaatggtgaaccactttgttcaggagttcaagagaaagaacaagaaggacatcaat
ggcaatccaagagctcttaggaggttgaggacagcatgtgagagggcaaagagaactctc
tcttccactgcccagactaccattgaaattgattctttgtatgaaggcgttgatttctac
tccaccattactcgtgcccgatttgaagagctcaacatggatctcttcaggaagtgcatg
gagcctgttgagaagtgtctgagggatgccaagatggacaagagcaccgtccatgatgtt
gtcctcgtcggtgggtcgaccagaattcccaaggtccagcagcttttgcaggacttcttc
aatgggaaggagctatgcaagagcatcaatcctgatgaggccgttgcttatggtgctgca
gtccaggctgctattttgagtggcgagggtaatgagaaggtgcaggatctcctgctcttg
gatgtcacccctctctccttgggtctggaaactattaataagatcttgactatcacagtt
gataacgcctcttctaatgatattgctgttgattatatgaggaggagaataaaggatagt
gattgtaccatattgggtggtgagtttcttcacatgcggtgtgctgcccatatattgaat
ttgattgttatggacggtttgagagaagtttatgagtttgtaacaagaattagagatgcc
gttagatatgtgaagtcttcaccgtcgaggtttgccaagttcaaggcttgtgcgtgcaaa
ggggatgagttggcggataggatagaggccaaggttaaactcttgttaaggcgcttgatt
gagcagtataacaaatttcgtgtggatagtggggggagttctaatgtggttcaagggagg
ccaagcactacttctacttctactactatgtcgactaaatttgatatcaggttagagaaa
tttcttttggagcaagggtttatggagtttagatcagaactagatcggtatttgtcggag
gggtgtgcacagaaatcacccagttttgatattttggattggtggagagttaatgccacc
aattatcctgtccttgctgagtggaaaaggaatagatttatctttgatggctcttttgct
cacccgaatgctattgtcaaggatgcaagaaggactatggatatgctaaatgaggaaaga
tcctggcaggtcagtgtgcaacattgcaactcagtcgagacttggcaggcccctccatca
gattggatcaaagtgaactgggatagtgcagtagacaagacagaaggtttgattggagtg
ggagtggttgctagggacaatgcaggacataccattgcttcaaagagaaccaagaaacac
ctcttccctgatccagcacttgcagaagcctatggagccctcattgcagtccagtttggc
ttggaacttgggctatctcaagtgatcattgaaggggactctctacaagtcattaatgct
ctaaaaagggaggaagaggggttcaatagtgctagtatgtttgttgaggaggctaaacat
cttcttaagttctttgccaagtag

DBGET integrated database retrieval system