KEGG   Juglans regia (English walnut): 108999574Help
Entry
108999574         CDS       T05245                                 

Definition
(RefSeq) probable receptor-like protein kinase At1g33260
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
jre  Juglans regia (English walnut)
Brite
KEGG Orthology (KO) [BR:jre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:jre01001]
    108999574
Enzymes [BR:jre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108999574
Protein kinases [BR:jre01001]
 Serine/threonine kinases: TKL group
  IRAK family
   108999574
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 108999574
NCBI-ProteinID: XP_018832020
UniProt: A0A2I4FK39
Position
Unknown
AA seq 155 aa AA seqDB search
LPPSSSPYSSSPMRRKHLMMGSPGYTDPHYLKTGIASKKNDVYSFGVVLLELVTGMEAFC
SERGQLLTSIVRPLLKDVRTLGATEVAEMVDPRLAEDYEPEEAKAMLSISALCLGQSPVL
RPSAKFILKSLRENISSISGLFPPEKLGSLKTRRL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
ctaccgccctcatcttctccatattcttcgtctcccatgaggaggaagcatttgatgatg
ggttcccccggttacactgatccacactacctgaaaacgggaatagcctcgaagaagaac
gatgtttacagcttcggagttgtcctcctggaacttgtgacggggatggaggcattctgc
tcggaaagggggcagctcttgacatccatagtcagacccttgctgaaggacgtccgcacg
ttgggagctacggaggtagcagaaatggtggatccgcggctggccgaggactatgaaccg
gaagaagccaaggccatgctttcaatctcggcactttgccttggccagtcgcccgtactc
aggccttctgccaaattcatcttgaaaagtcttcgggagaatatatcttctatctccggc
ttattcccgccggagaagcttggttccctaaagacccgtagactgtag

DBGET integrated database retrieval system