KEGG   Juglans regia (English walnut): 109002778Help
Entry
109002778         CDS       T05245                                 

Definition
(RefSeq) wall-associated receptor kinase 5-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
jre  Juglans regia (English walnut)
Brite
KEGG Orthology (KO) [BR:jre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:jre01001]
    109002778
Enzymes [BR:jre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109002778
Protein kinases [BR:jre01001]
 Serine/threonine kinases: TKL group
  IRAK family
   109002778
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr ABC1 APH
Motif
Other DBs
NCBI-GeneID: 109002778
NCBI-ProteinID: XP_018836211
UniProt: A0A2I4FX35
Position
Unknown
AA seq 411 aa AA seqDB search
MSAISLGLLGLFVGGSSIYCGLKRRKLIKLKEKFFEQNGGLLLQQKLSNDRTNSMEIAKI
FSAEELEKATNNYYESRVLGQGSYGTVYRGVLLDNKMVAIKKSKLGDQRQIEQFINEVIV
LTQINHRNVVKLLGCCLETEVPLLVYEFITNGTLSAHIQDRVLSSSLSWRKRLKIATDTA
GALAYMHFLTSMPIIHGDVKPANILLDDNYSAKVSDFGTSRLVSLDQTQLTTLVKGTFGY
LDPKYFHSSQLTKKSDVYSFGVAVAELLTGKKALSFDRPESDRNLAVIFCSAVKEDRLHQ
ILDDHIVSDGNINEINEVAKLVMQCLSVRGEDRPNMKKVAMELEGLRSMDQKHQWDKVDL
YTKEAECCATPPAQYSFSINGVNNGCSSTSATMGTSESMRNQLSLETNNIE
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctatcagccttggactcttaggattgtttgtgggaggttcttcaatatattgt
ggacttaaaagaagaaaactcatcaagttaaaagagaaattcttcgaacaaaatggtggc
ttgttgttgcaacaaaaactctcaaatgatagaactaattccatggagattgccaaaatc
tttagtgcggaagaacttgaaaaagctacaaacaattattatgagagtagagtacttggt
caaggaagctatggaactgtttatagaggagtcttactagataataaaatggtcgccatt
aaaaaatcaaaacttggtgatcagagacaaattgagcagttcataaatgaggtgattgtg
cttactcaaattaaccatagaaacgtggttaagttattaggttgctgtctagaaacagaa
gtgccattactagtttatgaattcatcacaaatggaactctttcggcccacattcaggat
agagtcctatcatcctcactctcatggagaaagcgtttgaagatagctacagatactgca
ggagcacttgcatacatgcattttttgacttccatgccaattatacacggagatgttaaa
cctgcgaatatacttttggatgataactattcagcgaaggtgtctgactttggaacttca
agattggtctcacttgatcaaacacaattaactactttggtgaagggaactttcggatac
ttagaccctaaatacttccatagtagtcaacttacaaaaaaaagtgatgtctacagcttt
ggggttgctgtggcagagttattgactggtaagaaagccctttcttttgataggcctgaa
agcgatagaaatttggcagtaatcttttgttctgcagtaaaagaggatcgcttacatcaa
attcttgatgaccatattgtaagcgatggtaatattaatgagataaacgaagttgctaag
cttgtaatgcaatgcttaagtgtaagaggagaggataggccaaatatgaagaaagtggca
atggagctagaggggttgagaagtatggatcaaaagcatcaatgggataaggttgatctc
tatacaaaagaggctgaatgctgtgccactccacctgcacagtactctttcagcattaat
ggtgtcaataatggttgttcttcgaccagcgcaacaatgggtacgtctgaaagtatgaga
aaccaattaagtcttgaaaccaataatattgaatga

DBGET integrated database retrieval system