KEGG   Juglans regia (English walnut): 109004423Help
Entry
109004423         CDS       T05245                                 

Definition
(RefSeq) pyruvate decarboxylase 1-like
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00010  Glycolysis / Gluconeogenesis
jre01100  Metabolic pathways
jre01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109004423
Enzymes [BR:jre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     109004423
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C NIBRIN_BRCT_II
Motif
Other DBs
NCBI-GeneID: 109004423
NCBI-ProteinID: XP_018838507
UniProt: A0A2I4G3N2
Position
Unknown
AA seq 585 aa AA seqDB search
MEAANHIASVPVYPAHSTGTLGRHLARRLVEIGATDVFSVPGDFNLTLLDHLIAEPELNL
IGCCNELNAGYAADGYARAKGVGVCVVTFTVGGLSVINAIAGGYSENLPVICIVGGPNTN
DFGTNRILHHTIGLPDFSQELRCFQTVTCAQAVVNNLDEAHELIDTAISTALKESKPAYI
SISCNLPGIPHPTFAGEPVPFFLAPTVSNQLALEAAVEATAEFLNKAVKPVIVGGPKLRV
SKAQKAFVELADASGYPIAVMPSGKGLVPEHHPHFIGTYWGAVSTSFVGEIVESADAYVF
VGPIFNDYSSVGYSLLIKKEKTIMVQPNGVTIANGPSFGCVYMADFLRALAKKLKGNSTA
LENYRRIFVPPGIPLKSEKEEPLRVNILFKHIQEMLDGDSAVIAETGDSWFNCQKLRLPE
NCGYEFQMQYGSIGWSVGATLGYAQAAKNKRVIACIGDGSFQVTAQDISTMIRCGQRTII
FLINNGGYTIEVEIHDGPYNVIKNWDYTGLVDAIHNGEGKCWTAKVKTECELTEAIATAT
GEQKDALCFIEVFVHKDDTSKELLEWGSRVSAANSRPPNQQEINK
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgctaatcacatcgctagcgtgcccgtctacccagcccactcgacaggaacg
ttggggcgccacctggccaggcggctcgtggagatcggcgccacggacgtgttctccgtc
cctggcgacttcaacctgacccttctggaccacctgatcgccgagccggagctgaactta
attggctgctgcaacgagctcaacgctggttacgccgccgacgggtacgcgcgtgccaag
ggcgtgggcgtgtgcgtggtcaccttcacggttggtgggctcagtgtgatcaacgctatt
gctggcggttacagtgagaatttgccggtgatttgtattgttggtgggcccaacaccaac
gattttgggactaatcggattctccatcacacgatcgggttgcccgatttctctcaagag
cttaggtgctttcagacagtcacttgtgctcaggcagtggtgaataacttggatgaagcg
cacgagctgatcgacacggcaatttcgactgccttaaaggaaagcaagccggcttatatt
agtatcagttgtaatttgcctggtattcctcatccgactttcgctggggagcccgtgccc
ttctttctggcaccgacggtcagcaatcagttagcattggaagcagctgtggaagcgaca
gctgagtttttgaataaagctgtgaagcctgtaattgtgggtgggcccaagttaagggta
tcaaaggcgcaaaaagcctttgtagagcttgcagatgccagcgggtatccaatagctgtt
atgccctcaggtaagggactagttccagagcaccatccccacttcattgggacatattgg
ggtgctgtcagcaccagctttgttggggagattgtggagtctgccgatgcctatgttttt
gtcggccccatctttaatgattacagctctgttggctactcccttttgatcaagaaggag
aaaacaataatggtgcagcctaatggtgtgacaattgccaatggtccttcttttggctgt
gtttacatggctgatttcttgcgtgcattggccaaaaagctcaagggaaacagcactgct
cttgagaattaccgccggatctttgtgcccccaggcatccctctaaaatctgagaaagaa
gagcctctaagggttaatattcttttcaagcacattcaggagatgcttgatggagacagt
gcagtaatagctgagactggagactcatggttcaattgccagaagctccgcctccctgag
aactgtgggtacgaatttcagatgcagtatggatctattggctggtcagtcggtgccact
cttggatatgctcaggctgctaaaaataagcgtgtgattgcttgtattggcgatggaagt
ttccaggttacagctcaggacatttcaacaatgattcgatgtggacaaaggaccattata
ttcctaatcaataatggaggttatacaattgaagtagagattcatgatggcccatacaat
gtgattaagaactgggactacactggccttgttgacgccatccacaatggcgaaggcaaa
tgctggactgccaaggtaaaaacagagtgtgaactgacagaagcgattgcaacggcgact
ggagaacaaaaagatgctttatgtttcattgaagtattcgtgcataaggatgacaccagc
aaagagcttctggagtggggatcccgagtttctgcagcaaacagccgccctccaaatcaa
caagaaataaataaataa

DBGET integrated database retrieval system