KEGG   Juglans regia (English walnut): 109004673Help
Entry
109004673         CDS       T05245                                 

Definition
(RefSeq) inositol-tetrakisphosphate 1-kinase 1-like
  KO
K00913  inositol-1,3,4-trisphosphate 5/6-kinase / inositol-tetrakisphosphate 1-kinase [EC:2.7.1.159 2.7.1.134]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00562  Inositol phosphate metabolism
jre01100  Metabolic pathways
jre04070  Phosphatidylinositol signaling system
Module
jre_M00132  Inositol phosphate metabolism, Ins(1,3,4)P3 => phytate
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    109004673
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    109004673
Enzymes [BR:jre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.134  inositol-tetrakisphosphate 1-kinase
     109004673
    2.7.1.159  inositol-1,3,4-trisphosphate 5/6-kinase
     109004673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins134_P3_kin Ins134_P3_kin_N
Motif
Other DBs
NCBI-GeneID: 109004673
NCBI-ProteinID: XP_018838851
UniProt: A0A2I4G4N6
Position
Unknown
AA seq 354 aa AA seqDB search
MAEAERCRFSVGYALAPKKQSSFIRDSLLVLARSHGVDLVHIDPTRPLVDQGPLDCVLHK
LYGDDWNRQLTEFRHRYPNAVIVDSPHSIERLHNRISMLQFVSELRIESPNETFGIPKQI
VIYDKETLFDRQAWESLKFPVIAKPLVADGSAKSHKMNLVFNHDGLNELKPPIVLQEFVN
HGGVIFKVYVVGVYVRCVKRKSLPDISEENLGTVSESVLSFSQVSNIATNEKVDGKYYKM
MHFDDTEMPPQRFLTDVADGLRRAMKLNLFNFDVIRDARFGNRYLIVDINYFPGYAKMPS
YETVLTDFFLDVVNKRKEIVYSCDEVMTKIVSNTFCSDEDEIGRKDRTDSSIKF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagctgaacggtgcaggtttagtgtaggttatgctttggcccccaagaaacaa
agcagcttcatccgagactccctccttgttcttgctaggtctcacggcgtcgatcttgtc
cacatcgaccccacccgccccctcgtcgatcagggccccttggactgcgtgctccacaag
ctgtacggagatgactggaatcggcagctcacagagttccgccaccgttaccctaatgcg
gtcatcgtcgactccccccactccatcgagcgcctccacaaccgaatctccatgctacag
ttcgtttcggagcttaggatcgagtccccgaacgagacgttcggtatccccaagcaaatc
gtcatctacgacaaggaaaccctcttcgataggcaagcctgggagagccttaagttccct
gtaatcgcgaagcccttggttgccgacggcagcgccaaatcgcacaaaatgaacttggtg
ttcaaccacgacggtctcaacgagctcaagcccccgatcgtcctccaagaattcgtgaac
cacggcggggttatcttcaaggtctacgtcgtcggcgtgtacgtcaggtgcgtgaaacgc
aagtcgttgccggacatctcggaagagaatttgggtactgtctctgaaagcgtattgtcg
ttttcgcaggtatcgaatatcgctaccaacgaaaaggtcgacggtaaatactacaagatg
atgcattttgacgacaccgaaatgccgccgcagcgttttctcactgatgtcgccgacggg
ttgcggcgcgccatgaaattgaacctgtttaacttcgacgtcattcgggacgcgaggttt
gggaatcgctaccttatagttgatatcaattactttcccgggtatgcaaaaatgccgtct
tacgagaccgtattgacggattttttcttggatgtggttaataagagaaaggagatagtg
tatagttgtgacgaagttatgacaaagatcgtcagcaatactttttgcagtgatgaagat
gaaattggccggaaagatcggacggatagttcgattaaattctga

DBGET integrated database retrieval system