KEGG   Juglans regia (English walnut): 109006212Help
Entry
109006212         CDS       T05245                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase CES101
Organism
jre  Juglans regia (English walnut)
Brite
Enzymes [BR:jre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109006212
Protein kinases [BR:jre01001]
 Serine/threonine kinases: TKL group
  IRAK family
   109006212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr DUF3403 Pkinase_fungal Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 109006212
NCBI-ProteinID: XP_018840966
UniProt: A0A2I4GAP7
Position
Unknown
AA seq 370 aa AA seqDB search
MCYLRKRKLKSKAKEPEALVNNIVAAGNLNSNVPDLQIFSYADIEMATSAFSFENKLGEG
GYGPVYKGILENGQEIAVKKLSKTSTQGFEEFKNEVTLTAKLQHVNLVRVLGFCIERDEQ
MLIYEYMPNKSLDFYLFDPARRFLLDWSKRIQVIEGITQGLLYLQEYSRLKVIHRDLKAS
NILLDNEMKPKISDFGMAKIFAKDEHEANTDRIVGTYGYIPPEYARQGLYSTKYDVYSFG
VLLLQIISGKKNAYCYGQEEDLNLLDYAYELWKSGKGMELMDPSLDDTFSSCKLITCLQI
ALLCVQENASDRPPMLKVFSMLRGETAALTVPKRPAFSTKRNEDHEGNKSELQQENCSMN
DTTMSQMEAR
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtgctatttaaggaagagaaagctaaaatcaaaagctaaagaaccagaagcactagtc
aacaacatagtagctgctgggaacttaaatagcaatgttcctgatcttcagatcttcagt
tatgctgatattgagatggctactagtgcattttcgtttgaaaataagctaggagagggt
ggatatggtcctgtttacaagggtatacttgaaaatggacaggaaatagcagtgaaaaaa
ctttcaaaaacttccacacagggctttgaggaattcaagaatgaggttacactcacagca
aaactgcaacatgttaatcttgtgagagttttgggattttgcatcgaaagggatgaacaa
atgctgatctacgaatacatgcctaacaaaagcttggacttctacctatttgatccggca
agaagatttcttttggattggagtaaacgcattcaagtcattgaagggattactcaagga
cttctatatctccaagaatattcaagattgaaagtaattcatcgagatctgaaagccagc
aatattttacttgacaacgagatgaagcctaagatatcagacttcggtatggcaaagatt
ttcgcaaaagatgaacatgaagcaaacaccgacaggattgttggaacatatggctacatt
cctccagaatatgctagacaaggtttatattcaaccaaatatgacgtttacagctttgga
gttttgctgttgcaaatcataagtggcaagaagaatgcctactgctatggacaggaggaa
gatttaaacctcctagactatgcatatgaactatggaaatcaggcaaaggcatggagcta
atggacccatcgttggatgatacattttcatcatgcaaattaatcacatgcctgcaaata
gctcttttgtgtgttcaggaaaatgcaagtgataggccacccatgttgaaggtgttttca
atgctaagaggtgaaactgctgctctcacagtcccaaaaaggccagctttttctacaaaa
agaaatgaagatcatgagggcaataaatctgaattgcaacaagaaaactgctccatgaac
gatacgacaatgtcccaaatggaagcccgataa

DBGET integrated database retrieval system