KEGG   Juglans regia (English walnut): 109006273Help
Entry
109006273         CDS       T05245                                 

Definition
(RefSeq) probable receptor-like protein kinase At5g20050
Organism
jre  Juglans regia (English walnut)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal YukC Pox_ser-thr_kin PIP49_C DUF2207
Motif
Other DBs
NCBI-GeneID: 109006273
NCBI-ProteinID: XP_018841043
UniProt: A0A2I4GAV7
Position
Unknown
AA seq 460 aa AA seqDB search
MEDKKANIIAVATVITVIVFIVVARVSLKLSKTFFLIFGAGIAVILAVLAYLIIRRHYNR
RRKFLESRLVSEGRELRIEYSFLRKVAGVPTKFRYRELEEATDNFQSLLGQGASATVYRG
ILNDGTAVAVKRINGEEHGEKEFRSEVSAIASVQHVNLVHLLGYCCNPGGPRFLVYEFIP
NGSLDYWIFPRRESRNRRGGCLSWALRYKVAIDVAKALSYLHHDCRSRVLHLDVKPENIL
LDENYRAIVADFGLSKLMGKDQSRIVTTIRGTRGYLAPEWLLEQGISEKSDIYSYGMVLL
EMIGGCRNVCLIETSTGNRSERRWRYFPKIVNQKIREGTLMEVVDRRLVEGGGGGGGGAI
DEREVRRLAYVALWCIQERAGMRPSMARVVEMLEGLVAVDEPPDTRMIVVDLLAIDDDQH
ESDARNGPQVAAMAAPRLVDSNNLPISLANSFAMSILSPR
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggaggacaagaaagcgaatataattgctgttgcaacagtgatcaccgtcatcgttttt
atcgttgttgctcgtgtcagtctcaagctttccaagactttctttctcatcttcggggca
ggtattgcagtgattcttgctgttcttgcgtacctaataatcagacgccattataatcgc
aggagaaagtttttggagtcaaggttagtctcagaaggccgagagcttcgtatagagtat
agttttctcaggaaagttgctggggttccgacaaagtttcgatacagggagctcgaggaa
gcaacagacaatttccagtcattgttaggccagggagcttctgcaacagtttatagagga
atcctaaacgatggcactgctgttgctgtgaaacggattaatggagaagagcacggggaa
aaggagttcagatcggaagtttcagccattgcgagtgtgcaacatgtaaatctcgtgcac
cttcttggttattgctgtaatcctgggggacctcgttttcttgtttacgagttcatccca
aatggttctttggattattggatctttcctagaagggaaagccggaatcggcgtgggggg
tgcttgtcgtgggcgttaaggtataaggttgccattgatgttgctaaagcactgtcttac
ctccatcacgattgccgatcaagggtcttacaccttgatgtcaaaccagaaaacatactt
cttgatgagaattatagagcaattgttgcagatttcggtctctcaaagcttatggggaaa
gatcagagtagaattgtcacaacaatccgagggactagaggttacttagcaccggagtgg
ctattggagcaaggaatttcagaaaaatctgacatctatagttatgggatggttcttcta
gagatgattggaggctgcagaaatgtttgcttgatagaaactagtaccggaaacaggtct
gaaaggaggtggagatatttcccgaaaatagtgaatcagaaaatcagagaagggacgctt
atggaagtggttgaccggaggctagtagaaggtggaggtggaggtggaggaggcgccatt
gatgagagggaggtaaggagattggcttatgtagctttgtggtgcatacaagagagggct
gggatgagacctagcatggctcgggtggttgagatgctggaaggtcttgtggctgtggac
gagcctcctgacacgcgaatgatcgttgttgatctattggcaatagacgacgatcagcat
gaatcggatgctcggaacgggccgcaggttgcagcaatggcggcaccacgcctagtggat
agcaataatcttcccatctcattagcaaattcatttgccatgtcaattctatctccaaga
tag

DBGET integrated database retrieval system