KEGG   Juglans regia (English walnut): 109007232Help
Entry
109007232         CDS       T05245                                 

Definition
(RefSeq) cysteine-rich receptor-like protein kinase 10 isoform X1
Organism
jre  Juglans regia (English walnut)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Stress-antifung APH Haspin_kinase DUF3403 TMEM154 DUF1198 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 109007232
NCBI-ProteinID: XP_018842366
UniProt: A0A2I4GEP9
Position
Unknown
AA seq 667 aa AA seqDB search
MPCFQFSKFLLSLFVIPLLSLTGEAAPTYRGHYCSVTTIATANRTLFAANGTYESNLKIV
LSSLSSNATRATTGFYNASAGENPAEVVSGLYLCRGDVNTTVCQDCVATATKEVRQLCPL
DKVALLWYDECFLRYSNLSIFATINEVPGVEINSTQNIGETEGDLFNDLLARTLNLLARR
AADSQSGKKFATGEVEFTDSQTLYSLLQCTPDLTDSDCFRCFQSAIGTLPMCCDRKQRGG
MLLPSCVVRYDMSPFYNITAASPTRPPLAPGGGKTSSLKILAIAIPIAVSMVLFFVGYRF
IQRRARKKYNTFPEEKAEVEIATVESLQFDLDTLETATNKFSEDNKIGEGGFGPVYKGIL
TNGQQIAVKRLSGGSGQGAEEFKNEIVLVAKLQHRNLVRLLGFCLEGDEKLLVYEYVPKK
SLDYFLFDTTKQQQLDWSMRYKIIGGIARGILYLHEDSRLRIIHRDLKASNVLLDDSMNP
KISDFGMARIFVVDQTQGNTSKIVGTYGYMSPEYAMHGRYSVKSDIFSFGVLVLEIISGK
KNSGFYQSEHAEDLLSFAWKQWTNRTPLELLDPTVRHSYSRNEVIRCIHMGLLCVQEDPA
NRPTMATIALMLDSYSVTLPLPQQPAFLHRSRAKPNRLTQELESDQSPGQSIAWSINEAS
FTEIHPR
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgccttgctttcaattttccaaattccttttgtctctcttcgtaattcccttgctaagc
cttaccggtgaagcagcacccacttaccgcggtcactactgctcggtgacgaccatcgcc
accgccaacaggacccttttcgccgccaacggcacctacgaatccaacctcaagatcgtc
ctctcttctctttcctctaacgccacccgtgccactactgggttctacaacgcctccgcc
ggtgaaaatcctgccgaggtggtctctgggctctatctctgccgtggcgacgtcaacacc
acagtctgtcaggactgcgttgccactgcaaccaaagaggtacgacaactctgcccgttg
gataaagtggctttattatggtacgacgagtgcttcttacggtactccaatctatccatc
ttcgccaccattaacgaagtgcccggggtagagataaacagcacgcagaatatcggagag
acagagggggatctgttcaatgacttgttggcccgcacgctgaatttgttggcgaggcga
gccgcggactctcaatcgggcaagaaatttgcgacgggggaagtggaattcaccgattca
cagacgctatatagcctgctgcagtgtacgcccgacctgaccgactccgattgctttaga
tgtttccaaagtgccatcggtactcttcctatgtgctgcgatagaaaacaacgcggaggt
atgctgctccccagttgtgttgttagatatgacatgagcccattttacaacatcactgct
gcttcgcctacacgtcctcctcttgctccaggaggaggcaaaacttcatcgctcaaaatt
cttgccattgccattccaattgctgtttctatggttcttttctttgtgggatatcgcttc
attcagagaagagcaaggaagaaatacaataccttcccagaagaaaaagctgaagttgaa
attgcaacagtcgagtccttgcaatttgacttggatacattagaaactgccacaaacaag
ttctctgaggataacaagataggtgaaggaggatttggtccagtttacaagggtatcctt
actaatggacaacaaattgctgtgaagaggctatctggaggatctggacagggtgcagaa
gagtttaagaatgagattgtgttggtggccaagcttcaacataggaatcttgtgagacta
ttgggattttgcttggaaggagacgagaagttacttgtctacgaatatgtgcccaagaaa
agccttgattactttctatttgacactacaaagcaacaacaattggattggtcgatgcgt
tacaagattataggaggaattgctcgagggatcctttatcttcatgaagattctcgcctt
agaattattcatcgtgatctcaaagctagcaatgttttgttagacgatagtatgaaccca
aagatttcggattttggaatggcaaggatatttgtcgtggatcaaactcaaggaaataca
agtaaaattgttggaacttatggttacatgtctccagagtatgctatgcatggacgatat
tctgtgaagtctgacatttttagcttcggagtcttggttctagagatcataagtggcaag
aagaacagtggtttctatcaatccgaacatgctgaggacctcttgagttttgcttggaag
caatggacaaacagaacacccttggaattgctggatcccacagtgagacattcttattca
agaaatgaagtgattaggtgcatccatatgggcttattatgcgttcaggaagatcccgca
aaccgacctacaatggcaacaatagctctcatgcttgacagttactctgttacgcttcca
ttacctcagcagccagcatttttacatcgaagcagagcaaagccaaacaggctaacacag
gagctggagtctgatcaatctccaggtcaatcaattgcatggtcaataaatgaagcatca
ttcactgaaatacaccctcgataa

DBGET integrated database retrieval system