KEGG   Juglans regia (English walnut): 109007258Help
Entry
109007258         CDS       T05245                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C isoform X1
  KO
K03252  translation initiation factor 3 subunit C
Organism
jre  Juglans regia (English walnut)
Pathway
jre03013  RNA transport
Brite
KEGG Orthology (KO) [BR:jre00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    109007258
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:jre03012]
    109007258
Translation factors [BR:jre03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    109007258
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3c_N PCI TRI5 DUF2982
Motif
Other DBs
NCBI-GeneID: 109007258
NCBI-ProteinID: XP_018842400
UniProt: A0A2I4GET7
Position
Unknown
AA seq 944 aa AA seqDB search
MASRFWTSQGGSDSEEEESDFDEEIENGGPGDATAQAAGSRYLQGNASDSDDSDGQKRVV
RSAKDKRFEEMSATVDQMKNAMKINDWVSLQESFDKINKQLEKVMRVTESEKVPNLYIKA
LVMLEDFLSQALANKDAKKKMSSSNAKALNSMKQKLKKNNKQYEDLITKCRENPESEEEK
DEEEEDEEDEETDSEIEEDPTKIEFKDSEDDDDDDDKAGDSQDEDDGAWEKKMSRKDKLM
DKQFKNPSEITWDKVNKKFKEVVAARGRKGTGRFEQVEQLSFLAKVAKTPAQKLEILFSV
VSAQFDVNPGLNGHMPISVWKKCVQNMLVILDILVQYPNIVVDDMVEPDENESQKGPEYD
GTIQVWGNLVAFVERIDVEFFKSLQCIDPHTREYVERLRDEPMFLVLAQNVQDYLERVRD
FKAAAKVSLKRVELIYYKPQEVYDAMRKLAELTGDGDNGEAGEEPKAVEETRSSSAFVAT
PELVPRKPTFPENSRTLMDSLVSLIYKYGDDRTKARAMLCDIYHHAILDEFSTSRDLLLM
SHLQDNIQHMDISTQILFNRAMAQLGLCAFRVGLIIEGHGCLSELYSGGRVKELLAQGVS
QSRYHEKTPEQERIERRRQMPYHMHINLELLEAVHLICAMLLEVPNMAANIHDAKRKVIS
KTLRRLLEVSERQTFTGPPENVRDHIMAATRALSMGDFEKSFDIVKSLDVWKLVRNRENV
LEMLKAKIKEEALRTYLFTYSLSYNSLSLDQLTVLFDLPEAQTHSIISKMMINEELNASW
DQPSRCIVFHDVEHTRLQALAFQLTEKLTVLAESNERAIEARMGGGLDLPLRRREGQDYT
TGASAGGNRWQDNSSFTQGRQGGSGRTGYGGGRPLALGQAAGGGYSRDRTGQSRGSNTGY
QGTRYQDAAYGGSGRTSYQSGSSARGSQGDTSTRMVSLNRGLRA
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgcgcttctggacatcccagggtggtagtgactccgaggaggaggagagtgat
tttgacgaagagattgagaatgggggacctggtgacgctactgctcaagctgctggaagc
agataccttcaggggaatgcaagtgatagtgatgactccgatggccaaaagcgggtcgtt
aggtctgcaaaggataagcgcttcgaggaaatgtcagctactgttgatcagatgaagaac
gcaatgaaaataaatgattgggtaagcttgcaagaaagctttgacaagataaataagcag
ctggagaaagttatgcgtgtcaccgagtctgaaaaggtccctaacctttacatcaaagcc
cttgtgatgttggaggacttcctgagtcaggctttggccaataaggatgcgaagaagaag
atgagcagcagcaatgctaaggccttgaactcaatgaaacagaagctgaagaagaacaac
aaacaatatgaggatttgataacaaagtgcagggaaaatcctgagagtgaggaggaaaag
gatgaggaagaggaagatgaggaggatgaagaaaccgactctgagattgaggaggatcca
actaagatagaattcaaagattctgaagatgatgatgacgatgatgacaaggctggggat
agccaagatgaggatgacggggcgtgggagaagaagatgagcaggaaagataagctgatg
gacaagcaattcaagaaccccagtgagatcacatgggataaggttaacaagaaattcaag
gaggtcgtggctgctcggggtaggaaaggaactggaaggtttgagcaggttgagcagctt
tcttttttggcaaaggttgccaagacccctgctcagaaacttgaaattctattcagtgtt
gtctcggcacaatttgatgtcaatcccggcctgaacggccacatgccaataagcgtatgg
aagaagtgtgtgcaaaatatgcttgtgatattggatattcttgttcagtatcccaacata
gttgtggatgatatggtcgagcctgatgagaatgaaagccagaagggaccagaatatgat
gggacaattcaggtttggggaaacttggttgcctttgtggaaaggatagatgttgagttt
ttcaagagcttgcaatgcattgatccgcacactcgtgagtatgttgagagactcagggat
gagcctatgtttttggttcttgctcaaaatgtccaggattatttagaacgggttcgggat
ttcaaagctgctgctaaggtttccttaaagcgggtcgaattaatatattataagccacaa
gaggtttatgatgccatgagaaaactggctgagctgacaggagatggagataatggagaa
gcaggtgaggagcctaaagcggtcgaggaaactagaagttcttctgcatttgtggctact
cctgagctcgtccctcggaaaccaacctttcctgagaatagcaggaccttgatggattct
ctggtatccctcatctacaagtatggagacgaccggactaaagcccgtgccatgctctgt
gatatttaccaccatgctatcttggatgagttttcaacttcacgtgacttgctccttatg
agccacttgcaagataacattcagcatatggacatatcaacgcagatccttttcaacagg
gcaatggcacaacttggtctatgtgcattccgtgtgggattaataattgagggccatggc
tgcctttctgaactatattcaggtggaagggtaaaggagttgcttgcacaaggtgtttct
caaagccgatatcatgagaagactccagaacaggaaaggattgaaaggaggcggcagatg
ccttaccatatgcacataaatttggagcttctggaggctgtacatctgatatgtgctatg
ctgctagaagtacccaacatggcagcaaacattcacgatgcaaagcgcaaggtcataagt
aagactctgaggcggttgcttgaggtgagtgagaggcaaacatttacaggtcccccagaa
aatgtcagagaccacataatggctgccaccagggcccttagcatgggagattttgaaaaa
tcttttgatattgtcaaatcccttgatgtgtggaagcttgttaggaatcgggagaatgtc
cttgagatgctcaaggctaagatcaaggaagaggctctgaggacctacctttttacctac
tcattatcctataattccctcagtttggaccagcttacggtattatttgacctgccagag
gcccagactcacagcatcatcagcaagatgatgattaatgaggagctcaatgcaagttgg
gaccagccaagcaggtgcatcgttttccatgatgttgagcacactaggttgcaggctctg
gcattccagttaacagagaagctaacagttcttgcagaaagtaatgagagagcaatagaa
gcaaggatggggggtggtttggatctgcctcttagacggagagaaggccaggattatact
actggagcgtctgctggaggaaataggtggcaagacaactcatctttcactcaaggaaga
caaggtggcagtgggcgtacaggatatggtggagggagacctttggcactaggccaagct
gctggaggtggttattcaagagaccggacaggtcagtcacgaggcagcaatactggctat
cagggtacacgttaccaagatgctgcatatggagggtccgggaggacttcttatcagagt
ggttcatctgcaaggggatcccaaggggatacttcaacccgcatggtcagtctcaacagg
gggctccgagcttag

DBGET integrated database retrieval system