KEGG   Juglans regia (English walnut): 109007464Help
Entry
109007464         CDS       T05245                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase At4g03230
Organism
jre  Juglans regia (English walnut)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr DUF3403 Pkinase_fungal APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 109007464
NCBI-ProteinID: XP_018842681
UniProt: A0A2I4GFL0
Position
Unknown
AA seq 225 aa AA seqDB search
MLDWATRIHIIKGIAQGLLYLHQHSRLKIIHRDIKPNNILLDGEMNPKISDFGMARLVGD
NEAQANTNRIVGTYGYMSPEYVMEGLYSIKSDVFSFGVLLLEIVSGEKNTGFYNRESLNL
LNHAWELWRDERSLELMDSVIGRPSSEGTIVRLINIGLLCVQASPSDQPTMFDVVSMMSN
EHAPLPIPKKPAFTTCRNSMHSNPKINYAENCSVNSVTISVLEAR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgttagattgggcgacacgcatacacattattaaagggattgctcaaggactgctatat
cttcatcagcattcaaggttaaaaatcatacatagagatataaagccaaacaacattctc
ttggatggtgaaatgaacccaaaaatatcagattttggcatggctcgactagttggagat
aacgaagcacaagcaaatacaaacaggattgttggaacttatggctacatgtctcctgaa
tatgttatggagggtctatactcgataaagtctgatgtgtttagctttggagtattgcta
ctagagattgtgagtggcgagaagaatacaggcttctacaacagagagtcactcaacctt
cttaaccatgcttgggagttgtggagagatgaacgaagtttggagttgatggattcagtg
atagggcgtccttcttccgagggtaccatagtgagattaattaacattgggctactttgc
gttcaagcatccccatctgatcaacctaccatgtttgatgtggtttcaatgatgagcaat
gaacatgcacctctacctatacccaagaaacctgcctttaccacatgtcggaattcaatg
cactcgaatccaaaaattaattatgcagaaaattgctcagtaaatagtgtaactatttca
gtgctggaagctagatga

DBGET integrated database retrieval system