KEGG   Juglans regia (English walnut): 109011099Help
Entry
109011099         CDS       T05245                                 

Definition
(RefSeq) tyrosine/DOPA decarboxylase 2-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00350  Tyrosine metabolism
jre00360  Phenylalanine metabolism
jre00380  Tryptophan metabolism
jre00950  Isoquinoline alkaloid biosynthesis
jre00965  Betalain biosynthesis
jre01100  Metabolic pathways
jre01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    109011099
   00360 Phenylalanine metabolism
    109011099
   00380 Tryptophan metabolism
    109011099
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    109011099
   00950 Isoquinoline alkaloid biosynthesis
    109011099
   00965 Betalain biosynthesis
    109011099
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:jre04147]
    109011099
Enzymes [BR:jre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     109011099
    4.1.1.105  L-tryptophan decarboxylase
     109011099
Exosome [BR:jre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109011099
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2 DUF1148
Motif
Other DBs
NCBI-GeneID: 109011099
NCBI-ProteinID: XP_018847711
UniProt: A0A2I4GUY2
Position
Unknown
AA seq 522 aa AA seqDB search
MNGLNFDHELNHMTSSNNTNPLDPEEFRRQGHMIVDFLADYYADIEKYPVLSQVEPGYLQ
KHLPKSTPHDPEPIETILQDVKDHIIPGITHWQSPNFFAYFQCTSSIAGFLCEMLCTGFN
VVGFNWIASPVATELETIVMDWLGGMLNLPNSFLFSGNGGGVIQGTTCEAILCTMVAARD
QMLRRVGRQNMEKLVVYGSDQTHSALQKAAQIAGINPKNFRAIKTTKSTSFALSPDSLRS
AIRADMEAGLVPLYLCANVGTTSTTAIDPLGSLCDVAKDYGLWVHVDVAYAGSACICFEF
RHFMDGVEGVNSLSLNAHKWLFTSLDCCCLWVKDPSALIKSLSTNPEFLRNKAFDSKQVV
DYKDWQITLSRRFRALKLWFVLRSYGAANLRNFMRSHVKMAKLFEGFVAMDKRFEIVVPR
NFAMICFRINLPSTMGKGVYQNGKVGDNGPMLLKENITTANELNKKLLESINASGRVYMT
HTVLEDMYVIRFAVGATLVEERHVIMAWKVVQEHATAILSNN
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcctaaattttgaccatgaactaaatcacatgacttcttccaataacacaaac
ccactagatcctgaggagtttaggcgacaaggccacatgatcgtagacttcctagccgat
tactatgcagatatcgagaaatatccagtcctaagccaagttgaaccaggatatctccaa
aaacacttgccaaagtccaccccacatgatccagaacccatcgaaaccattctccaagac
gtgaaagaccatattattcctggtataacgcattggcaaagccctaacttctttgcctac
ttccaatgcacaagtagcatagcagggtttctctgtgagatgctttgcactggattcaat
gtggtcgggttcaactggattgcatccccagttgcgactgaactggagacgatagtcatg
gattggcttggagggatgctcaacctgcctaactcttttctattttcgggcaatggaggt
ggagtgatacaagggactacttgtgaggccattttgtgcacaatggtcgctgccagggat
caaatgcttcgccgagttgggaggcaaaatatggaaaagctggtagtttatgggtctgac
caaacacatagcgcactccaaaaagcggcacaaatagcaggaatcaacccaaagaatttc
agagccatcaagaccactaagtccacatcatttgcgctctcaccagactccctacgatca
gccattcgtgcagatatggaagcaggcctggtcccattgtacctatgtgccaatgtgggg
acaacatcaacgactgccattgatccattagggtcattatgtgatgtggcaaaagattat
ggcctttgggtccacgttgatgttgcttatgccggaagtgcttgcatttgttttgagttt
cggcatttcatggatggcgttgagggtgtaaactcactcagtctcaatgcacataaatgg
ctcttcacctctttagattgttgttgcctttgggttaaagatccaagcgccttgataaaa
tcactatcaacaaaccccgagttcttgagaaataaagcctttgattcgaagcaagtggtc
gactataaagactggcaaataactctaagccgaagattccgagccttaaagttatggttc
gtgcttagaagctatggagcggctaacctgaggaacttcatgagaagtcatgttaaaatg
gccaaactttttgaagggtttgtagcaatggacaagaggttcgagattgtggtccccaga
aattttgccatgatttgtttcaggattaatctgccatcaacaatgggtaagggggtatat
caaaatggaaaggtgggtgataatggtccaatgttactaaaagaaaatatcaccactgca
aatgagcttaacaagaagttattggagtccattaacgcatcaggtcgtgtttacatgact
cataccgtacttgaggatatgtatgtaatacggtttgcggttggtgcaactctggtagag
gaaagacacgttataatggcttggaaggtggtacaggagcatgcgactgccatactaagc
aacaactaa

DBGET integrated database retrieval system