KEGG   Juglans regia (English walnut): 109011390Help
Entry
109011390         CDS       T05245                                 

Definition
(RefSeq) acid beta-fructofuranosidase-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00052  Galactose metabolism
jre00500  Starch and sucrose metabolism
jre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109011390
   00500 Starch and sucrose metabolism
    109011390
Enzymes [BR:jre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     109011390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 109011390
NCBI-ProteinID: XP_018848119
UniProt: A0A2I4GW47
Position
Unknown
AA seq 662 aa AA seqDB search
MVVSTLLRSFSSKHEDPAAATLPSSTTPLLYEPHPGELDLERRWPPKRAALVVIFGFLLL
ALFLAILIADLNSDVHANGNVSLATSGSSMASEPLKLVSRGVSAGVSEKANGVFACVNVV
SFPWNNTMLSWQRTAYHFQPEKNWMNDPNGPMYYKGWYHFFYQYNPNGAVWGDIVWGHAV
SKDLIHWLHLPLAMVADQWYDMNGVWTGSATILPDGQVIMLYTGSTNESVQVQNLAYPAN
LSDPLLINWVKYSGNPVLHPPPGIDSQDFRDPTTAWYTSDGKWNIAIGSKVNKTGITLIY
STEDFKNFELSDGVLYSFPGTGMWECVDFYPVSNTSIKGLDTSVKGPGVKHVIKTSLDQD
RNDYYTLGTYDEKTGKWVPDNTTIGLGLRYDYGMFYASKSFYDLHKGRRVLWGWIQESDS
EIADVKKGWASVQSIPRTVLLDTKTGTNLLQWPVEEVDSLRLTSKVFDKVEVKAGSVVPL
DVGTATQVDIVAEFELDKEALERTAQTNVEFSCSTSGGAAERGALGPFGLLVLADESLNE
HTPVYFYIAKGTDGNLTTFFCADQTRSSEATDVDKKIYGSTIPILKDEKLSVRLLVDHSI
IESFAQGGRTCITSRVYPTKAIYGAARIFLFNNATEASVTSSLKIWQMNSAFIRPFRPEQ
DN
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggtggtgtctaccctattacggtccttctcatcaaagcatgaggaccccgccgccgcc
accttacctagctccaccacccctctcctctatgaaccccaccccggggaattggatctg
gagaggcgctggccacccaagagggctgccctcgtggtcatttttgggttcttgttgctt
gcactatttttggccattctcattgctgatctgaattcagatgtccatgcaaatgggaat
gtatcattggctacgtcgggatcatcgatggcgtcggagcccttgaagctggtgtcacgt
ggggtatccgctggcgtgtccgagaaggcgaacggggtatttgcctgcgtcaatgtcgtg
tcgtttccatggaacaataccatgttgtcatggcagaggactgcttatcatttccagcct
gagaagaattggatgaacgatcctaacggccctatgtattacaagggatggtaccacttc
ttttaccaatacaatcctaatggagcagtgtggggtgacatagtttggggtcatgctgtc
tccaaggacctgatacattggcttcacctccccttagcaatggttgctgatcagtggtat
gacatgaatggtgtttggacaggatctgctacaatccttcctgatggccaagttatcatg
ctttacactggatccacaaatgaatcagtgcaggttcaaaatcttgcatatccagccaac
ttgtctgatcccctcctcataaactgggtcaagtactctggcaacccggtccttcaccct
ccaccaggcattgattcgcaggatttccgtgacccaacaacggcttggtacacctcggac
gggaaatggaacattgccatagggtccaaggttaacaaaacaggcattactttgatctac
agcaccgaggacttcaagaacttcgagctttcagatggggtgctgtattctttccctggc
actggaatgtgggagtgtgtggacttctatcctgtgtctaatacatctataaagggtttg
gacacatcggttaagggccctggagtgaagcatgtaatcaaaacaagccttgatcaggat
agaaacgattattatacactcgggacttatgatgagaagacaggtaaatgggttcctgat
aacaccacgattggtcttggattgaggtatgactatgggatgttttacgcatccaaatcg
ttctatgatttgcataagggaaggagggtgttgtggggttggattcaagagtctgatagt
gaaattgctgatgtgaagaagggctgggcatcagttcagagtattccaaggacagtgttg
cttgatacaaagactggtaccaatttgcttcaatggccagtggaggaggtagacagtttg
agattgaccagcaaagtgtttgacaaggtggaggtcaaggcaggatcagtcgttcctcta
gatgttggcacagccacgcaggtagatattgtcgccgagtttgagttagataaggaggct
ttagagaggacagcccaaaccaatgtggaattcagctgcagcaccagtggtggagctgct
gaacgtggcgcactgggaccctttggacttcttgttcttgcagatgagagccttaacgag
cacactcctgtgtatttctatattgccaaaggaactgacggcaatctcacaactttcttc
tgtgctgatcaaacaaggtcttctgaggcaactgatgtcgataaaaaaatttatgggagc
accattccaatactaaaagatgaaaagttgtctgtgagattactggtggatcattcaatc
attgaaagctttgctcaaggtgggaggacctgcatcacttctcgtgtctatccaacaaaa
gcaatctatggagctgctcggatatttctgttcaacaatgctactgaagccagtgtgact
tcatctctcaagatatggcagatgaattctgcattcatacgccccttccgccctgagcaa
gataattga

DBGET integrated database retrieval system