KEGG   Juglans regia (English walnut): 109011737Help
Entry
109011737         CDS       T05245                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00052  Galactose metabolism
jre00500  Starch and sucrose metabolism
jre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109011737
   00500 Starch and sucrose metabolism
    109011737
Enzymes [BR:jre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     109011737
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 109011737
NCBI-ProteinID: XP_018848589
UniProt: A0A2I4GXG9
Position
Unknown
AA seq 573 aa AA seqDB search
MAISPAWLVFCFLFLNHGVVELEASHQVYRDLKLSSSPPEHQPYRTSFHFQPPKNWINDP
NGPMIYRGLYHLLYQYNTKGAIWGNIVWAHSTSTDLVNWTPHEPAIYPSQTSDINGCWSG
STTILPWGTPVILYTGIDPQNRQVQNMAVPKNLSDPYLREWVKSPKNPLMAPTAANQINA
SSFRDPTTAWLGPDGSWRLLVGSKRYSRGVAILYRSKDFFHWVKSQHPLHSAKGTGMWEC
PDFFPVLINSKLGVDTSTMGTDVKYVLKLSLDDTKHDYYTVGTYNINKDIYIPDKGQVDG
DSGLRYDYGKFYASKTFFDSAKNRRILWGWINESSSVNDDIKKGWAGVQAIPRALWLDVS
QKQLVQWPIREIEKLRGNEVHLPKQVLKGGLALEVSGVTASQADVEVSFGISELEKAEVL
DPSWKNPQVLCSKKGALVDGSLGPFGVLALASKGMQEYTAVFFRIFKGHADKYVVLMCSD
QSRSSLNNNNDKTTYGAFLNVDPVRKKVLSLRSLIDHSIVESFGGEGKVCITARVYPTLA
IDDKAHLHVFNYGTQNVQITGLSAWSMKKARIY
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggccatctctcctgcttggctagtcttttgttttctttttctcaaccatggtgttgtt
gagcttgaagcttcccaccaggtttacagagaccttaagctttcttcatctcctcctgaa
catcagccttatcgaacttcttttcacttccaaccccccaagaactggatcaatgatcct
aatggaccaatgatttacagggggctttaccatctgctctaccaatataataccaaaggt
gcaatttggggcaatattgtctgggcccactccacatcaacggacttggtgaactggacc
ccacacgagccggccatctacccatcacagacatcggatatcaacggttgctggtcgggc
tccaccacaatccttccctggggcaccccagtcatcctctacacaggaattgatccccag
aataggcaagtccagaacatggccgtgcccaaaaacctctctgacccataccttagggaa
tgggtcaagtctcccaaaaacccactaatggcaccaactgcagctaaccaaattaatgca
agctcctttagggacccaaccactgcttggttaggtcctgatgggtcatggagactgctc
gttggaagcaaaaggtactcccgtggagtagctattctgtacaggtctaaagatttcttt
cattgggtaaaatcccagcacccacttcactctgcaaaaggcaccggaatgtgggaatgc
cccgactttttcccggttttgattaattccaaacttggtgttgacacatcaactatgggc
acagatgttaaatatgtgcttaagttgagcttggatgacactaaacacgattactatact
gttggaacttataacatcaacaaggatatctatattccggacaaggggcaggtggacggc
gactcgggcttgagatacgattatggaaagttctatgcttcaaaaactttctttgatagt
gcaaagaacagaagaattttgtggggctggattaatgagtcttcgagtgtcaacgatgat
attaagaagggatgggctggagttcaggcaattccaagggctctttggcttgatgtatcc
caaaaacaattggtgcaatggcccattagagaaattgaaaagctgcgtggaaatgaagtc
cacttgcctaagcaagtgcttaagggaggattagctcttgaagtttctggtgtcacagca
tcacaggctgatgttgaggtttcattcggaataagtgagctggaaaaggcagaagtgctg
gatccgagttggaaaaatccgcaagtgctttgcagtaaaaagggcgcattagttgatggg
agtttaggaccatttggagtcttggctttagcttcaaagggtatgcaagagtacacggca
gtgttctttagaatatttaaagggcatgcagacaaatatgtggtgctgatgtgcagtgac
caaagcaggtcttccctgaataacaataatgacaaaacaacttatggggcttttctgaat
gtggaccctgttcgtaagaaagtactgtcacttcgaagtttgattgatcattcgatagtg
gagagctttggtggagaaggaaaagtttgcatcacggctagagtttaccccacattggca
attgatgacaaggcccacttgcatgttttcaactatggaactcagaatgtccagatcaca
ggactcagtgcttggagcatgaagaaagctcgaatctattaa

DBGET integrated database retrieval system