KEGG   Juglans regia (English walnut): 109013659Help
Entry
109013659         CDS       T05245                                 

Definition
(RefSeq) (-)-germacrene D synthase-like isoform X1
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    109013659
Enzymes [BR:jre01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     109013659
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth_C Terpene_synth
Motif
Other DBs
NCBI-GeneID: 109013659
NCBI-ProteinID: XP_018851365
UniProt: A0A2I4H5E0
Position
Unknown
AA seq 566 aa AA seqDB search
MSIPVSGAGLSQNSKPNVVRRTANFPPSVWGDRFINYTSDDEKTQARRVREVEEMIKEVR
RELLASACQPSQQLNLIDALQRLGVAYHLDREIQLEALEHMHAGYHDNKADSSGDEDHDL
YNVALRFRLLRQQGLRVSCDVFNKFKDEKDNFKESLSTNIPGILALYEATHLRVHGEDIL
DEALAFTTAQLKSAASHLSNPIAAKVNHALKQPLHKGIPRLEARHFISIYQDDTSHKKAF
LKLAILDFNLVQSLHKQELTEITRWWKDLDFATKLPFARDRVVECFLWIVAVYFEPRHSP
ERKMLTKIIAMASTIDDIYDAYGTLEELEIFTETIERWEIGTIDQLPQYMQICYRALLDI
FKEIEQELAKQGRPHLVIYAKKAMKILVRAYFNEAKSFNMKKIPTMEEYMEIAIPSSGYP
MLIAVSFVFMGEIVTKEAFEWIFSNPKVITASAVIARLMDDSGSHKFEQERGHAASAVEC
YMNQYGISETQLAYKELNRQVSNAWKDINEEFTRPNAMPMPLLMCVLNFSRAIDVIYKNG
DGYTRVGKEMSDNVAAVLIHPVPIIV
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcccagtctcaggagctggtctttcccaaaacagcaaacccaatgttgtgcgg
aggactgcaaattttccccccagcgtttggggtgaccgtttcatcaactacacctccgat
gacgagaaaacccaagctcgtagagtacgtgaagttgaagaaatgatcaaagaagtgaga
agggaactgttagcctccgcgtgtcagccttcgcaacagctgaacctaattgatgcgctt
cagcgccttggcgtggcgtatcacttagatagagagatacaattagaagcgctagaacat
atgcatgctggctatcatgacaataaggctgatagtagtggagatgaagaccacgatctg
tataatgttgcccttcgctttcgactactacgtcaacaaggacttcgtgtttcatgtgat
gtgtttaacaagtttaaagatgaaaaggataacttcaaggaaagtttgagcaccaacatt
ccgggcatcctagccttgtatgaagctacgcatcttagggtgcacggagaagacatcctt
gatgaggcccttgctttcaccaccgctcaactcaagtccgctgcatcccatttaagcaat
ccaatagcagcaaaagttaatcatgccctaaagcaacccctgcacaagggcataccaagg
cttgaggcaagacacttcatttctatctaccaagatgacacttcacataaaaaagctttc
ctgaagcttgcaatactagatttcaatttggtgcagtcgttgcacaaacaggaacttact
gaaatcaccaggtggtggaaagatttagactttgcaacgaaactaccttttgcaagagac
agggttgtggagtgttttttatggattgtggcagtctattttgagcctcggcactcgcct
gaaagaaaaatgctaacgaaaattattgccatggcatccaccatagatgatatttatgac
gcatatggcactcttgaagaactcgagatctttacagaaacgattgagaggtgggaaatt
ggcacaatagatcaacttccacagtacatgcaaatatgttatagggcacttttggacatt
ttcaaagaaattgagcaggagctggcaaaacaaggaagaccacatcttgtaatctatgca
aaaaaagctatgaaaatattagtccgggcctacttcaacgaagccaaatctttcaacatg
aaaaaaatcccaacgatggaagagtatatggaaatcgcaataccaagctccggttaccca
atgctcatagccgtctcatttgttttcatgggtgaaatagttacaaaggaggcctttgaa
tggatcttcagcaacccaaaggttataacagcatcagcagtaattgctaggctcatggat
gacagtgggtcacataagtttgagcaagagagagggcatgctgcctcggcagttgaatgc
tacatgaaccaatatgggatctctgaaacacaactggcatataaagaactgaacaggcaa
gtttctaatgcatggaaagacatcaatgaggaatttaccaggcctaatgctatgccaatg
cctctccttatgtgtgttttaaatttttcacgagcaatagatgtcatctacaagaacggg
gatggatatacccgtgtggggaaagagatgtcagataacgtggcagcagtgctcatacat
ccggtgccaataatagtatga

DBGET integrated database retrieval system