KEGG   Juglans regia (English walnut): 109014459Help
Entry
109014459         CDS       T05245                                 

Definition
(RefSeq) probable phospholipid hydroperoxide glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00480  Glutathione metabolism
jre00590  Arachidonic acid metabolism
jre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    109014459
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109014459
Enzymes [BR:jre01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     109014459
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 109014459
NCBI-ProteinID: XP_018852474
UniProt: A0A2I4H8J7
Position
Unknown
AA seq 238 aa AA seqDB search
MLRFAPHFLLHKNHFLRPVAASFPLSRRILSDKKQTLLCSSQVSLVSLLTPPIKTGLLGP
VLCNLHSVRAMAGQSQNSTVHDFTVKDARGNDVDLSQYKGKTLLIVNVASQCGLTNSNYT
ELSQLYGKYKDQGLEILAFPCNQFGAQEPGNNEQILEFACTRFKAEYPIFDKVDVNGKDA
APLYKFLKSSKGGLFGDNIKWNFSKFLVDKDGNVVDRYAPTTSPLSIEKDIKKLLGSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgctccggttcgctcctcactttctcctccataaaaaccatttcttgcgacccgtagct
gcgtcctttcccttgtcaaggcggatcttatccgataaaaagcaaacccttttgtgctct
tcgcaggtttctctagtttctttgttaactccgccaatcaagaccggtttattggggcca
gtgttgtgtaatttgcattcggttcgggcaatggctggccaatcccagaacagcacagtc
cacgatttcaccgtcaaggatgctaggggaaacgatgttgatctcagccagtataagggg
aagaccctcttgatcgtaaatgtcgcatcccaatgtggcttgactaattctaactatact
gagttgagtcagttgtacgggaaatacaaagatcaaggattggagattttggcattccca
tgcaatcagtttggagctcaggagccagggaacaatgaacagatcttagagtttgcttgc
actcgtttcaaggcagagtaccctatatttgataaggtggatgtgaatggtaaagatgct
gctccgttgtacaagttcttgaagtctagcaaaggtggcctattcggagacaatataaag
tggaatttttcgaaattcctggttgataaagatggtaatgttgttgaccgttatgccccc
acaacctcccctctcagcattgagaaagatataaagaagctgttggggagtgcttga

DBGET integrated database retrieval system