KEGG   Juglans regia (English walnut): 109014683Help
Entry
109014683         CDS       T05245                                 

Definition
(RefSeq) cysteine-rich receptor-like protein kinase 25
Organism
jre  Juglans regia (English walnut)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Stress-antifung DUF3403 APH SKG6 TMEM108 MLANA ABC1 Haspin_kinase Pkinase_fungal DUF4448
Motif
Other DBs
NCBI-GeneID: 109014683
NCBI-ProteinID: XP_018852726
UniProt: A0A2I4H9A5
Position
Unknown
AA seq 662 aa AA seqDB search
MNSPSLPILVLSMISFLCLTTHAADPVYLTHFCKNTTFPQNSFYNSSLNSLFSSLSSNAT
RYLEFYNATSGQNTSDPVYGIFLCRGDVIADMCRTCVATSTKDLASKCSRERVAVIWYDE
CMIRYSNESIISTVAVRPRVLMYNEQNISDPDGFNRLLNTTLIELARQASNFPIGVKKYG
TKEVKMSGFQNLYSLVQCTPDLSSTDCNRCLQAAINLLPRCCDGKQGGRVIFPSCNFRYE
LYPFYRGTATAPTPAPSLPPPPGSTTGSKGKSKISTTTIVAIVVPISVTAVLFILGCCCL
IRRRKKYNGAKGENAVNDITTVESLQFDFSTIEAATKKFSDDSKLGAGGFGEVYKGTLPN
GQEIAVKRLSKSSRQGAEQFKNEVVLVAKLQHRNLTRLLGFCLEGQEKILVYEFVPNKSL
DNFLYDPTKHEQLNWSTRYKIIAGIARGTQYLHQDSRLRIIHRDLKASNILLDADMNPKI
SDFGMARIFGVDQTQGNTSRIVGTYGYMSPEYAMRGEFSVKSDVYSFGVLILEIISGKKN
STFYESDGAEDLLSYAWMHWRDGTALDLLDPVLGDSYSRDEVMRCIHIGLLCVQEDPAER
PTMGSIVLTLNSYSVTLAAPQQPAFFIRRTDMSTKDLKPDQSTSNLMPWSVNEASITELH
PR
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgaattctccctctcttcccatcttggtcctttccatgatcagcttcctctgcctgacc
actcatgcagccgacccagtttacctcacccacttctgtaaaaacacaactttccctcaa
aacagcttctataattccagtctcaattccctcttctcttccctctcatccaacgctacc
cgctacctcgagttctacaacgccacctctgggcaaaacacctccgaccccgtctacggc
atcttcctctgccgtggtgatgtcatcgccgatatgtgccggacatgcgtggccacctcg
accaaagacctcgccagtaagtgttcccgggaaagggtggccgttatttggtacgacgag
tgcatgattcgctactccaatgagtctatcatctccaccgtggccgtcaggcccagagtt
ttgatgtataacgaacagaacatctcggatccggacgggtttaacaggctgttgaatacg
acgttgatcgaattggcaaggcaggcctcgaactttccaatcggtgtaaaaaaatatgga
accaaggaagtgaaaatgtccgggtttcaaaacctgtacagccttgtacagtgcacaccg
gacttgtcgagcaccgactgcaataggtgtcttcaggcagcgatcaatcttctacccaga
tgttgtgacggaaagcaagggggaagagtaatttttccaagttgtaattttaggtacgaa
ttgtatcctttttatagaggtacagctacggcccccacgcctgctccatctctacctcca
cctccaggctccacaactggatcaaaaggaaaaagcaaaatctcaacaacaactatagtc
gccattgttgttccaatttctgtcactgcggtgctgttcattttgggctgctgttgcctg
attaggagaagaaagaaatacaatggtgcaaaaggagaaaatgctgtaaatgatattaca
actgtagagtccttgcaatttgattttagtacaatcgaagctgccacaaaaaagttctca
gatgatagcaagcttggtgcaggtggatttggtgaggtttacaagggtacacttcctaat
ggtcaagaaatagccgtgaagagactatcaaagagctctagacaaggtgcagaacaattc
aagaatgaggttgtattggtagctaagcttcaacacagaaatttaacaaggctattggga
ttttgcttggaaggacaagaaaagatactcgtctatgaatttgtgcccaacaaaagcctc
gacaattttctatatgaccctacaaaacatgaacaactgaattggtcaacacgttacaag
ataatagccgggattgctcgaggaactcaatatcttcaccaagattctcgacttagaatt
atacatcgtgatctcaaagctagcaatatattgctagatgccgatatgaatccaaaaatt
tcagattttggcatggcaaggatctttggtgttgatcaaactcagggaaacacaagtaga
attgtgggaacttatggctacatgtctccggagtacgcaatgcgtggagaattttctgtg
aaatcggatgtctatagttttggtgtcttaattctagagattattagtggcaagaagaac
agtactttctatgaatcagatggtgctgaggacctcttgagctatgcttggatgcattgg
agggatggtacagcgttggatttgttggatccagttttgggagattcttattcgagagat
gaagtcatgagatgcatccatattgggttattatgtgttcaggaagatccagcagagaga
ccaaccatgggatccatagttctcacactaaacagctactctgttacactggcagcacct
caacagcctgcatttttcattcgcagaacagacatgtcaacaaaggatctgaaacctgat
caatcaacaagcaatttaatgccatggtctgttaacgaagcatccattactgaactacac
cctcgctaa

DBGET integrated database retrieval system