KEGG   Juglans regia (English walnut): 109015234Help
Entry
109015234         CDS       T05245                                 

Definition
(RefSeq) thiamine thiazole synthase, chloroplastic
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00730  Thiamine metabolism
jre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    109015234
Enzymes [BR:jre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     109015234
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4
Motif
Other DBs
NCBI-GeneID: 109015234
NCBI-ProteinID: XP_018853257
UniProt: A0A2I4HAW2
Position
Unknown
AA seq 180 aa AA seqDB search
MSKLLARPNVKLFNAVAAEDLIVKGGRVGGVVTNWALVSMNHDTQSCMDPNVMEAKVVVS
SCGHDGPFGATGVKRLKSIGMIDSVPGMKALDMNAAEDAIVRLTREIVPGMIVTGMEVAE
IDGSPRMGPTFGAMMISGQKAAHLALKSLGLPNAIDGSYVGSIHPELILAAADSVETADA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagctcctggctcgccccaacgtgaagctcttcaacgcggtggcggccgaggac
ttgatcgtgaagggagggagagttggtggggtggtgacgaactgggcactggtgtcgatg
aaccacgacacgcagtcgtgcatggatcctaacgtaatggaggccaaggtggtggtgagc
tcgtgcggccacgacgggcctttcggtgccactggggtcaagaggctaaagagtattggg
atgattgacagcgtgcccgggatgaaggcactggacatgaatgccgccgaggatgctatt
gtaaggctcacaagggagattgtgcctgggatgattgtcactgggatggaagttgctgag
attgatggatccccaagaatgggtcccacctttggagcgatgatgatatcagggcaaaag
gcagctcacttggccttgaagtcgctgggacttcccaatgcaattgatggttcatatgtt
ggaagcatccacccggagctgatccttgctgctgcagattctgttgaaactgccgacgca
taa

DBGET integrated database retrieval system