KEGG   Juglans regia (English walnut): 109017539Help
Entry
109017539         CDS       T05245                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00630  Glyoxylate and dicarboxylate metabolism
jre00710  Carbon fixation in photosynthetic organisms
jre01100  Metabolic pathways
jre01110  Biosynthesis of secondary metabolites
jre01200  Carbon metabolism
Module
jre_M00165  Reductive pentose phosphate cycle (Calvin cycle)
jre_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
jre_M00532  Photorespiration
jre_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:jre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    109017539
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    109017539
Enzymes [BR:jre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     109017539
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 109017539
NCBI-ProteinID: XP_018855324
UniProt: A0A2I4HGN0
Position
Unknown
AA seq 183 aa AA seqDB search
MASSIISSTAIASVNRASPAKAAMVAPFTGLKSASAFPVTRKHNTDITSIASNGGRVQCM
QVWPPLGKKKFETLSYLPPLTAESLAKEVDYLIRKGWIPCLEFELEHGFVYRENNRSPGY
YDGRYWVMWKLPMFGCTDSSQVLKELEECKKEYPNAFVRIIGFDNKRQVQCISFIAYKPP
SHV
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctccatcatctcatccacggctattgcctcggttaacagagcctctccggct
aaagctgccatggtcgcacctttcaccggtctcaagtcggcctcggccttccctgtcacc
cgcaaacacaacactgatattacctccatagccagcaatggcggaagagttcagtgcatg
caggtatggcctccacttggaaagaagaagtttgagactctctcttacctacctcctctc
actgctgaatcattggccaaggaagtggattatctgattcgcaagggatggattccttgt
ttggagttcgagttggagcacggcttcgtttaccgtgagaacaatagatctccagggtac
tacgatggtcgctactgggtaatgtggaagctccccatgtttggctgcaccgactcttct
caggtcctgaaagagcttgaggagtgcaagaaggaataccccaatgcattcgttcgtatc
attggatttgacaacaagcgccaagtgcagtgcatcagtttcattgcctacaagcctcca
agccacgtctaa

DBGET integrated database retrieval system