KEGG   Juglans regia (English walnut): 109020705Help
Entry
109020705         CDS       T05245                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK9
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
jre  Juglans regia (English walnut)
Brite
KEGG Orthology (KO) [BR:jre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:jre01001]
    109020705
   01009 Protein phosphatases and associated proteins [BR:jre01009]
    109020705
Enzymes [BR:jre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109020705
Protein kinases [BR:jre01001]
 Serine/threonine kinases: Other
  Wnk family
   109020705
Protein phosphatases and associated proteins [BR:jre01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109020705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal Nbl1_Borealin_N
Motif
Other DBs
NCBI-GeneID: 109020705
NCBI-ProteinID: XP_018858771
UniProt: A0A2I4HRJ0
Position
Unknown
AA seq 736 aa AA seqDB search
MNGVSAVEPDYSEFVEVDPTGRYGRYNEILGKGASKTVYRAFDEYEGIEVAWNQVKLYDF
LQNPEDLERLYCEIHLLKTLKHNNIMKFYTSWVDTAKRNINFVTEMFTSGTLRQYRLKHR
RVNIRAVKHWCRQILKGLLYLHSRNPPVIHRDLKCDNIFINGNQGEVKIGDLGLAAILRK
SHAAHCVGTPEFMAPEVYEEEYNELVDIYSFGMCILEMVTFEYPYSECTHPAQIYKKVVS
GKKPEALYKVKDPEVRQFVEKCLAAVSHRLSARELLKDPFLQIDDYGFCLSSVEYRGDFD
ELGPFLRQSHYGSYNINHSFIDGYSNCLGYSGENDLEYHPVEFGMSEIDLFTCQEDEHLA
DVDITIKGRRREDDGIFLRLRMADKEGRIRNIYFPFDIETDTALSVATEMVAELDITDQD
MIKVADMIDSEISTLVPEWNRGLGIEESLHCTNGNFCHNCVSKDSLLDYVSSNCPGPKNL
QVLQCSKQGCAAIHGRFEEITYQVEGSEQCVTAGELKTSSQFGGIHFADIWAQREGLELS
SPGSKDICCNEGDNTLDQLTFGNERTINMDDQSEYDARNSPSTTRSAEHALLDDYENEIR
QELRWLKAKYQLQLRELRDQQLGAKWKSSSLSQKSFNFEHERDNGFSPPMPQLKRENNGP
LLKSLPSGKNFTTDFLIDADRKCSTVANRMTENSETVNVSYSPENMFTAKNFYTGPLLLP
HSLQRATSLPVDAVDV
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtgtttcagctgttgaaccggattactctgagtttgttgaagttgatcctact
ggaagatatggaagatacaatgaaattcttggcaaaggagcttcaaagacagtttataga
gcctttgatgagtatgaagggattgaagtagcatggaatcaggtgaagctttatgacttc
ctacaaaatcctgaagatcttgagaggctgtactgtgaaattcatctgctcaagaccctt
aaacacaacaacatcatgaagttctacacttcttgggttgatactgctaagaggaacatt
aactttgtcaccgagatgttcacctctggtactctcagacagtataggctgaagcacagg
agagtgaacattagagccgtgaaacattggtgtagacagattttgaaagggcttctgtat
ctccacagccgtaacccacctgttatccacagagacctcaagtgtgacaacatttttatc
aacgggaaccaaggggaagtcaagattggagatcttggcctcgcagcaatccttcgcaaa
tctcatgccgctcactgtgtcggaacacccgagttcatggcaccggaggtttatgaagag
gaatacaatgaattagttgacatatattcttttggaatgtgcatcttggagatggtcacg
tttgaatatccatacagtgaatgcacccaccctgctcagatatacaagaaagttgtctct
gggaaaaaaccagaagctctttacaaagtaaaagatcccgaggtgcgacaatttgttgag
aaatgcttagcagccgtgtcacataggctctctgctagggagcttctgaaggaccctttt
ctacaaattgatgactatggattctgcttaagttcagtagagtaccgaggagattttgat
gaactgggccctttcctaagacaatctcattatggaagttataacataaaccattctttc
atcgatgggtacagcaattgtcttggttattccggtgaaaatgatttggaataccatcca
gttgagtttggaatgagtgaaattgatctcttcacttgtcaagaggatgagcatttggca
gatgtagatatcacaatcaaagggaggagaagagaagatgatggcatcttcttaaggctc
agaatggcagataaagaaggccgtattcgaaatatctacttcccattcgacattgagact
gacacagcattgagtgttgcaacagaaatggtggcggagcttgatattactgaccaagat
atgataaaagtagcagacatgattgatagtgaaatttccactttggtcccagagtggaat
agggggctgggcatagaggaaagtttacattgtacaaatggaaatttctgtcacaattgt
gtttcaaaagattccctattggattatgtttcatcaaattgtccaggtcccaagaatctg
caagttcttcagtgttctaaacaaggatgtgctgctatccatggacgtttcgaagagata
acataccaagttgaagggtcggaacaatgtgtaacagctggggagctaaaaacatcaagc
cagtttggtggcatccattttgctgatatctgggctcagagagaaggtttagaattgagt
tcaccaggctcgaaggatatatgttgcaatgaaggagacaacacattggaccaattgacg
tttggaaatgagagaactataaatatggatgatcaaagtgaatatgatgcaagaaactct
ccctccacaacccgttcagcagagcatgccctcttggatgattatgagaatgagatcagg
caagaattaagatggctcaaagctaaatatcaattgcagttgagggaactcagagaccaa
caacttggggcgaaatggaaatcttcaagcttatctcagaagtctttcaactttgaacat
gagagagataatggattttcccctcctatgccccagctaaaaagagagaacaatggacct
cttctgaaatctttgccctctgggaagaatttcactacggattttctcattgatgctgat
aggaaatgctccactgtggcaaaccgaatgaccgaaaactctgagacagtgaatgtgtcc
tacagtcctgagaacatgtttacagccaagaatttctacacgggacctttgctgcttcca
cactctcttcaaagggcaacttctcttccagttgatgctgtagatgtttaa

DBGET integrated database retrieval system