KEGG   Juglans regia (English walnut): 109021019Help
Entry
109021019         CDS       T05245                                 

Definition
(RefSeq) cysteine--tRNA ligase 2, cytoplasmic-like isoform X1
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
jre  Juglans regia (English walnut)
Pathway
jre00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:jre00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    109021019
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:jre01007]
    109021019
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:jre03016]
    109021019
Enzymes [BR:jre01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     109021019
Amino acid related enzymes [BR:jre01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   109021019
Transfer RNA biogenesis [BR:jre03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    109021019
 Prokaryotic Type
    109021019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1 tRNA-synt_1f IL28A DUF2067
Motif
Other DBs
NCBI-GeneID: 109021019
NCBI-ProteinID: XP_018859103
UniProt: A0A2I4HSH7
Position
Unknown
AA seq 527 aa AA seqDB search
MANEEEFRVYNSMTQQKEIFKTHEPGRVGMYVCGVTAYDLSHLGHARAAVNFDVLFRYLQ
HLGYQVTYVRNFTDVDDKIFRRANELGEEPLSLSNRFCEEYLVDMADLQCLTPTHQPRVS
DHMEQIKDMITQIINNDCAYLVDGDVFFAVDKSPNYGQLSGQKLENHRAGERVAVDSRKR
NPADFALWKGAKPGELSWDSPWGPGRPGWHIECSAMSAHYLSFRFDIHGGGIDLIFPHHE
NEIAQTCAACQESRVSYWMHNGHVTNNNEKMSKSLGNFFTIREITQRYHPLALRHFLISA
HYRSPLNYTVSQLDGASDAVYYIYQTLQDCEDALSPFQEGSLKEVPEQKGKTARVTSVAQ
ECISNLRSEFQTKMSDDLNTAQILTVAFQEALKFINSSLNTLKKKQPKQQQLSMIESLIA
VEKEVKEVLNILGLLSSSTYLEVLEQLKDKALKRAGLVENDVLHLIEERTLARKNKDFSK
SDQIRADLTVKGIALMDVGDETIWRPCVPVEQERNALPVEQTASTTD
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatgaggaggaatttcgtgtgtacaactccatgactcagcagaaggagatcttc
aagacgcacgagccggggcgtgttggcatgtacgtctgtggcgtcactgcctacgacctc
agccacctcggtcacgctcgcgctgccgtcaatttcgacgtccttttcagatacttacag
cacttgggctatcaagttacttacgtgcggaatttcactgatgttgatgacaagatattt
cgtagagcaaatgagcttggggaagaacccttaagtttaagtaaccgtttttgcgaagaa
tatcttgtcgacatggctgatcttcagtgcctcactccaacccatcagcctcgcgtttct
gatcacatggaacagataaaggatatgataactcagattatcaacaatgattgtgcgtac
ttggttgatggagatgtattttttgctgttgataaatccccaaattatggccagttatct
gggcagaaattggaaaaccacagggctggtgaacgagttgctgttgactcaagaaagcgt
aatccagctgacttcgcattgtggaagggtgcaaaacctggcgagctaagttgggacagt
ccatggggtcctggaagaccggggtggcacatagaatgcagtgcaatgagtgctcattac
ctttccttccgatttgatattcatggtggtggaattgatttgatctttccacatcatgaa
aatgagattgcacagacctgtgctgcttgccaagagagccgtgtgagttactggatgcat
aatgggcatgtcactaataacaatgagaaaatgtccaagtcattgggtaatttcttcaca
attcgtgagataactcaacggtatcatccactggctttgagacattttctgataagcgca
cactatagatctcctctcaattatacagtctcacagctggatggtgcatcagatgctgtt
tattacatatatcagactttgcaagactgtgaagatgctttatccccatttcaagaagga
agccttaaggaggtgccagaacagaaaggcaaaacagcgcgggttacttctgttgcccaa
gagtgcatcagtaacctacgcagtgagtttcagactaaaatgtcagatgacttgaacact
gcacagatattgactgttgcttttcaagaagccttgaagttcataaacagttctttgaac
acgctcaagaagaagcaaccgaagcaacaacagttatcgatgattgagtctcttatcgca
gtggagaaagaagttaaagaagttcttaatattctagggttactatcctcttccacgtac
ttggaggttctggagcaattaaaggacaaggctttgaagagagcagggttagtggaaaat
gatgtgttgcatctgattgaagaaagaactctagcaaggaaaaacaaggatttctcgaag
agtgatcagatcagggctgatttaactgtgaagggcattgcgctgatggatgtgggagat
gaaactatttggagaccatgtgtcccagttgaacaggaacgtaatgccctgccagttgaa
caaacagccagcaccactgactga

DBGET integrated database retrieval system