KEGG   Juglans regia (English walnut): 109021568Help
Entry
109021568         CDS       T05245                                 

Definition
(RefSeq) probable leucine-rich repeat receptor-like protein kinase At5g49770
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
jre  Juglans regia (English walnut)
Brite
KEGG Orthology (KO) [BR:jre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:jre01001]
    109021568
Enzymes [BR:jre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109021568
Protein kinases [BR:jre01001]
 Serine/threonine kinases: TKL group
  IRAK family
   109021568
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase DUF667 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 109021568
NCBI-ProteinID: XP_018859771
UniProt: A0A2I4DHF1
Position
Unknown
AA seq 303 aa AA seqDB search
MLKSACGAAFHWWRLDSFFVETYAVRQKRRAEAAIGFRNPFAYWKSSGNDRSGAAPQLKG
ARLFSYDELRKCTNNFAERNEIGSGAYGKVYKGLLSDGLVNVAIKRAQQGSTQGLLEFKT
EIELLSRVHHKNLVGLVGFCIEQGEQMLVYEFMPNGTIRDSLSGKSGIYLDWNRRLYVAL
GSARGLAYLHEHANPPIIHRDIKSTNILLDENLTAKVADFGLSKLVSDDLKGHVSTQVKG
TMVSHVIISLPHLSRVDQNINKRVIILLIKVKNQLLSIKIIFNVMIYRIYAEFEGKKQLS
HIQ
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagagtgcgtgtggagcagcttttcattggtggaggcttgattctttctttgtt
gagacatatgcagttcgacaaaagagacgtgcagaagctgccattggatttaggaacccg
tttgcttattggaaatcaagtggcaatgatagaagtggggcagcaccacaattaaaaggt
gcaagattgttctcttatgatgaactccgaaagtgcacaaataatttcgccgagagaaat
gagataggttctggagcatatggcaaggtttataaggggttgctttccgatggactagtt
aatgttgctatcaaaagagctcagcaaggatcaacgcagggtttacttgagttcaagact
gaaattgaattgctttcccgagttcatcacaagaatcttgttggccttgtgggtttttgc
attgaacaaggagagcagatgctggtttacgaatttatgcctaatggaacaattagagat
agcttatcagggaaatctggcatttatcttgattggaacagaagactttacgttgctctt
ggttcagccagaggactagcttacctacatgagcatgccaatcctcctattatccataga
gatattaagtccacgaatattctgttggatgaaaatttgactgcaaaggttgcagatttt
ggcttgtctaagctagtatcagatgatttgaaaggccacgtttcaactcaagtcaaaggc
acgatggtaagtcatgttattatatccctacctcatctctcaagagtagatcagaatatt
aataaaagagtcataatattattaatcaaagttaaaaaccaacttttatctataaaaatt
attttcaatgtcatgatatatagaatatatgcagaattcgaaggtaaaaaacaactcagt
cacattcaatga

DBGET integrated database retrieval system