KEGG   Juglans regia (English walnut): 109021677Help
Entry
109021677         CDS       T05245                                 

Definition
(RefSeq) MDIS1-interacting receptor like kinase 2-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
jre  Juglans regia (English walnut)
Brite
KEGG Orthology (KO) [BR:jre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:jre01001]
    109021677
Enzymes [BR:jre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109021677
Protein kinases [BR:jre01001]
 Serine/threonine kinases: TKL group
  IRAK family
   109021677
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 109021677
NCBI-ProteinID: XP_018859909
UniProt: A0A2I4HUT3
Position
Unknown
AA seq 279 aa AA seqDB search
MFLLVFPLLGAVSVLLSFLGFFLFKQRRTDLEPKQNKIEGQVFLSILLFNGRTLYVEIIK
VTNGFDALYCAGKGGHETVYKAELTSGPAVAMNKLNQPLHEVHGNRFQKEFLNEIRALTD
IRHRNIVKLFGFCSNVQHSFLVCQYVERGNLSLILGNEDAAKVLGWSKRLNIAKGVAYAL
SYMHYDCSPPIIHQDISSSNILLDSQFEAHVSNFKSAKFLELDSSNWTSLAGTYGYIALE
LAYTMKVTEKCDVYSFGVLAIEVTSGKHPGDLSPHYHRS
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttctcgttttcccgcttttaggagcagtttctgttctactttctttccttggg
ttttttctctttaagcaaagaaggacagatctagaacccaaacaaaacaagattgagggc
caagtatttctttcaatattactattcaatggaagaacattgtatgttgaaatcataaaa
gtgaccaatggttttgatgctctatactgtgctgggaaaggaggacatgaaactgtctat
aaagcagagctaacttcaggacctgccgtagctatgaataaactcaatcaaccactgcat
gaagttcatgggaatagatttcaaaaggagttcttgaatgagataagggcattgacagac
atacgacatcgaaacattgtgaaactttttggtttttgttccaatgtgcaacattccttt
ttggtttgtcagtatgtagagaggggtaacttgtccctaatcttgggcaacgaagatgct
gctaaagtattgggctggagtaagagattgaatattgctaaaggtgtggcatatgccttg
tcatacatgcactatgattgctcccctccgattattcatcaggacatatcaagtagcaac
atcttgttggattctcaatttgaggctcatgtttcaaactttaagagtgctaagtttttg
gagctagactcatccaattggacttcccttgcaggcacctatggatatattgcactagag
cttgcttatacaatgaaggtaactgaaaaatgtgatgtgtatagctttggggtattggca
atcgaagtcactagtggaaagcatccaggtgatttatctcctcactatcatcgcagttag

DBGET integrated database retrieval system