KEGG   Juglans regia (English walnut): 109021784Help
Entry
109021784         CDS       T05245                                 

Definition
(RefSeq) G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330 isoform X1
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
jre  Juglans regia (English walnut)
Brite
KEGG Orthology (KO) [BR:jre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:jre01001]
    109021784
Enzymes [BR:jre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109021784
Protein kinases [BR:jre01001]
 Serine/threonine kinases: TKL group
  IRAK family
   109021784
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: B_lectin Pkinase Pkinase_Tyr S_locus_glycop PAN_2 TMEM154 Haspin_kinase EB APH EphA2_TM
Motif
Other DBs
NCBI-GeneID: 109021784
NCBI-ProteinID: XP_018860043
UniProt: A0A2I4HV84
Position
Unknown
AA seq 688 aa AA seqDB search
MILLPGHQSSASFSRTRATSRVMGLDRTINYLSYFLVLLSSFCLELGHATDTIAAPNFIK
DSETIISNDGEFILGFFSPANSTYRYVGIWYAKLSTTHAIWVANRNKPLKTTSGILTISE
DGNLVVLDGEKNIIWSSNVTGSVSNRSAQLLDSGNLVLHENTNTSIMWESFQHPSDSFLP
KMKMSTNIVTGEKVQFTSWKSQSDPAVGTFSLGISVFNLPEIYIWNGSSPYWRSGPWDGQ
IFIGVPNMNSRYLNGFNLIDDKEGSFSFIFEFSNKSLLAHYVLTAQGNVLVYSTINGKDL
VVWRSSLMSECNVYGKCGAYGYCNLKNKPICSCLEGFEPKNIEEWKREDWTSGCVRRKPL
QCFKVSTGGREGKKDGFLKVKMMKTPSLANWSSASEDECRYWCLENCSCIAYAYESGIGC
MSWTREYLIDSEQFSSGGVDLYIRVASSELDKKEEVKVNVIVTVLVIGIVLIVAVCTLFL
CRRRAKRKGFQGEENLVDNMNQDKLQELPIFSLEELASATNNFHQSNKLGQGGFGPVYKG
KLLDGQEIAVKRLAKSSGQGLAEFMNEVVVISKLQHRNLVRLLGGCVEGEEKLLVYEYMP
NKSLDAFLFDPINQELVDWKKRFNIIEGVGRGLLYLHRDSRLKIIHRDLKASNILLDEEL
NPKISDFGMARIFGGNEDQANTERIVGT
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgatattgctcccagggcatcaaagttcagcttcattttcacgaacaagagcaacttca
agagttatgggacttgatcgaaccataaactacttatcatattttcttgtcttgctatct
tccttttgtttagagcttggccatgcgacggacaccatcgcagcacccaactttatcaaa
gattccgaaaccataatctccaatgacggtgagttcatattgggctttttcagccctgcc
aattctacttatcgctatgttgggatatggtatgctaaactttccacaactcatgccata
tgggttgctaataggaacaagcccctgaagaccacctccgggattcttactatatcggaa
gacggcaatctagtcgtattagatggagaaaagaatattatttggtcatcaaatgtaaca
ggttctgtttctaatcgaagcgcccaacttctagattccgggaaccttgtcttgcatgaa
aacactaacacatcaatcatgtgggaaagtttccaacatccttcagattcatttctacca
aagatgaaaatgagtactaacatagtaactggagagaaagtgcagttcacatcatggaag
agccagtcagatccagccgttggaaccttttctctcggtatttccgtttttaatcttcca
gaaatatacatttggaatggcagtagcccttactggcgaagtgggccatgggatggtcag
atctttattggagtaccaaacatgaattcccgatatcttaatggatttaatcttatagat
gataaagaaggatcattctcttttatctttgagttctcaaacaagtctttgttagcgcat
tacgtcttgactgctcaaggaaacgtattggtatattctactattaatgggaaggatttg
gtggtctggcggtcgtctttgatgtctgagtgcaacgtttacggcaagtgtggggcatat
ggatattgtaacctaaaaaataaaccgatctgcagctgcttagaggggtttgaaccaaag
aatattgaagaatggaaaagagaagattggactagtggatgtgtgaggaggaaacccttg
cagtgtttcaaagtgagcacaggtggtagagaaggcaaaaaagatgggtttttgaaggtg
aagatgatgaaaacgccaagtttggcaaattggtcatctgcttctgaggatgaatgtaga
tattggtgcttggagaactgttcttgtatagcttacgcatatgaatctggcattgggtgt
atgtcatggaccagagaatacttaatagactcggaacaattctccagtggtggagtcgat
ctttatattcgcgtggcctcttcagaacttgataaaaaggaagaagtgaaagtaaacgtc
atagtcacagtactggtcataggaatagtcttgatcgtggcggtgtgcactttattctta
tgccggaggagggctaaacgtaaaggatttcaaggtgaagaaaatcttgtggacaacatg
aaccaagataaactccaagagctaccgatattcagtcttgaggaactagcgagtgcaacg
aacaacttccaccaatctaacaaactaggacaaggtggatttggtcccgtatacaaggga
aaattgttagatggacaagaaattgccgtaaaacgacttgcaaaatcttcagggcaaggg
ctagcagaatttatgaatgaagtcgtagtgatttctaaactccaacaccgaaatcttgtt
agactccttggtgggtgtgttgaaggagaagaaaagttgctagtctatgaatacatgcca
aacaaaagtttggatgcatttctttttgatccaatcaaccaagaactggtagattggaaa
aaacgtttcaacattattgaaggagttggtcgtggtctactctaccttcatagggattca
agattaaaaattattcatagggatctaaaagcaagtaacatattgttggatgaagagcta
aatccaaaaatatcagactttggaatggccaggatttttggaggcaatgaagaccaagcc
aatactgaaaggattgtgggaacatag

DBGET integrated database retrieval system