KEGG   Juglans regia (English walnut): 26380826Help
Entry
26380826          CDS       T05245                                 

Gene name
rpl22, AT063_gp026
Definition
(RefSeq) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
jre  Juglans regia (English walnut)
Pathway
jre03010  Ribosome
Brite
KEGG Orthology (KO) [BR:jre00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    26380826 (rpl22)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:jre03011]
    26380826 (rpl22)
Ribosome [BR:jre03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    26380826 (rpl22)
  Bacteria
    26380826 (rpl22)
  Archaea
    26380826 (rpl22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22 DUF5513
Motif
Other DBs
NCBI-GeneID: 26380826
NCBI-ProteinID: YP_009186207
UniProt: A0A0S2MA45
AA seq 145 aa AA seqDB search
MSTNKARRVIDKIRGRSYEETLMVLELMPYQTCYPLFKLVYSAAANAIHNMGLNESSLII
SKVEVNKGTTVKKLKPRAQGPSYPIKRPTCHITILLKDISVNEEYYKRSKYAILCLKNPG
WLKKNKYTDMTRYNICGIGGLWGKK
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgtctactaacaaagcacgaagagtaattgataaaattcgtggacgttcctacgaagaa
acacttatggtactagaacttatgccttatcaaacatgttatccactttttaaattggtt
tattctgcagcagcaaatgctattcacaatatgggtttaaacgaatcaagtttaatcatt
agtaaagtggaagttaacaagggtactactgtgaaaaaattaaagcctagagctcaaggg
cctagttatccaataaaaagacccacgtgtcatataactattctattaaaagatatatcc
gtaaacgaagaatattataaaagatccaaatacgccatattatgcttaaaaaaccctgga
tggctaaaaaaaaacaagtacacagatatgacgcgttataatatatgtggtatcggggga
ttatggggcaaaaaataa

DBGET integrated database retrieval system