KEGG   Janthinobacterium svalbardensis: CNX70_01840Help
Entry
CNX70_01840       CDS       T05119                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
jsv  Janthinobacterium svalbardensis
Pathway
jsv00480  Glutathione metabolism
jsv00590  Arachidonic acid metabolism
jsv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jsv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    CNX70_01840
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CNX70_01840
Enzymes [BR:jsv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CNX70_01840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ATD63584
UniProt: A0A290X366
Position
439987..440580
Genome map
AA seq 197 aa AA seqDB search
MSKTLAQLFALTTLAAGASLAMPAHAADTAPAAAAPAACPAILKQTFNRLQDEAPQNLCQ
YAGKVVLVVNTASYCGFTNQYEGLEALYAKYGSKGLVVLGFPSNDFGKQEPGNSKEIADF
CYNTYGVKFPMFSKSVVSGPAPNPLYVDLIKQTGKTPAWNFHKYLIDRHGKVVESFPSKV
TPDDKKLVGAVEKALAL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagacccttgcccagctgtttgcgctgaccacccttgccgccggcgccagcctg
gccatgccggcccatgccgccgacaccgcgccagctgccgccgcgccagcggcctgtccc
gccatcctcaagcagaccttcaaccgtttgcaggatgaggcaccgcaaaacctgtgccag
tacgcgggcaaggtcgtgctggtggtcaatacggccagttattgtggttttaccaaccag
tatgaagggctcgaagcgctgtacgccaagtacggcagcaagggcctggtggtgctgggt
ttcccgtcgaacgatttcggcaagcaggagccgggcaacagcaaggaaatcgccgatttc
tgctacaacacctatggcgtgaagttccccatgttttcgaagtccgtcgtctccggcccc
gcgcccaacccgctgtacgtggacctgatcaagcagacgggcaagacgccggcctggaat
ttccataaatacctgatcgaccgccacggtaaagtggtggaaagcttccccagcaaggtg
acgccggacgacaagaaactcgttggcgcggtggaaaaagcgctggcgctgtaa

DBGET integrated database retrieval system