KEGG   Janthinobacterium svalbardensis: CNX70_05305Help
Entry
CNX70_05305       CDS       T05119                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
jsv  Janthinobacterium svalbardensis
Pathway
jsv00480  Glutathione metabolism
jsv00590  Arachidonic acid metabolism
jsv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jsv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    CNX70_05305
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CNX70_05305
Enzymes [BR:jsv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CNX70_05305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ATD59663
UniProt: A0A290WS04
Position
complement(1206856..1207341)
Genome map
AA seq 161 aa AA seqDB search
MRSIHAFQAEALDGTPVDLARYKGKVLLIVNTASACGFTPQYQGLEALYREFHDQGLVVL
GFPCNQFRQQEPGSNGEIAAFCEKNFGVTFPLFAKIDVNGPHTHPLFAQLKQAAPGIFGT
QSIKWNFTKFLVRKDGSVFRRYATASKPASLAADIRQLIQE
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcatccacgctttccaggccgaggcgctggacggcacgccggtcgacctggcg
cgctacaagggcaaggtattgctgatcgtcaacacggccagcgcctgcggtttcacgccg
caataccagggcctggaagcgctgtaccgcgaattccacgaccagggcctggtcgtgctg
ggctttccctgcaatcaattccgccagcaggaaccgggctcgaacggggaaatcgctgcc
ttttgcgagaaaaacttcggcgtcacctttcccctgtttgccaagatcgatgtgaatggc
ccgcatacccatcccctgtttgcgcaattaaaacaggcggcgcccggcatattcggcacg
cagtcgatcaaatggaatttcaccaagtttttggtgcgcaaggatggcagcgtatttcgc
cgctatgcgacggccagcaaaccggccagcctggcggccgacattcggcaattaatacag
gaatag

DBGET integrated database retrieval system