KEGG   Janthinobacterium svalbardensis: CNX70_11075Help
Entry
CNX70_11075       CDS       T05119                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
jsv  Janthinobacterium svalbardensis
Pathway
jsv00450  Selenocompound metabolism
jsv00970  Aminoacyl-tRNA biosynthesis
jsv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jsv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CNX70_11075
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CNX70_11075
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:jsv01007]
    CNX70_11075
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:jsv03016]
    CNX70_11075
Enzymes [BR:jsv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CNX70_11075
Amino acid related enzymes [BR:jsv01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CNX70_11075
Transfer RNA biogenesis [BR:jsv03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CNX70_11075
 Prokaryotic type
   Other AARSs
    CNX70_11075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ATD60656
UniProt: A0A290WVK5
Position
complement(2469840..2471999)
Genome map
AA seq 719 aa AA seqDB search
MTRKLFVTTALPYANAAFHIGHIMEYIQADIWVRFQRMQRDGAAGREVHFVGADDTHGTP
IMIAAEKEGITPQQFVANIAAGRAQYLDGFHIAFDNWYSTDSPENVDLSQSIYRKLRDTG
LIVTKTVDRFFDPVKGMFLADRNIKGECPKCGAKNQYGDNCEVCGAAYQPTDLVNPFSVF
TNATPVMKPSEQYFFKLSDPRCFEFLKDWLNTPGRLQPEMVNKVSEWLGEAGEKLADWDI
SRDAPYFGIPIPDAPGKFFYVWMDAPVGYLASLKNYCDKKGIDFDAFLNDPSTEQIHFIG
KDIVSFHLLFWPAMLKFANHPVIDKLKVNVHGFLTVNNEKMSKSRGTGISPLRYLDLGMN
PEWLRYYIAFKLNSKVEDLDFNGEDFVARVNSDLIGKYVNIASRCAGFIAKRFDGKLAST
LSEGAQSWINRALTVDVNGVIVERQASIAAHFENREFGKALREIMEIADITNQYVDENKP
WILAKDAEKTAELHDVCTTALILFRQLTILLSPVLPGVAKNVASFLNDAAFSWADTQVFG
DAVANSMLGRTIGAYSHLMTRMDAKMIEALFDAPQAAPAIAAPAGDAANDAAAPEAATAA
AIEELAPEIKIDDFLKIDLRIAKIVNCELVEGSDKLLRLTLDAGEGRLRNVFSGIRSAYQ
PEELVGKLTVLVANLAPRKMKFGISEGMVMAASAADEKTNPGIYILNPWPGAEPGMRIR
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcaagctgttcgtcaccactgccctgccttacgcaaacgccgcttttcacatt
ggccacatcatggaatacatccaggctgatatctgggtccggttccagcgaatgcaacgc
gatggcgcagccggccgtgaagtgcactttgtgggcgccgacgatacgcatggcacgccc
atcatgatcgccgccgaaaaagaaggcatcacgccgcagcaattcgtcgccaacatcgcc
gccggccgcgcccagtacctcgatggcttccatatcgccttcgataactggtattcgacc
gactcgccggaaaacgtcgacctgtcgcaatcgatctaccgcaagctgcgcgatacgggc
ctgatcgtcacgaaaaccgtcgaccgcttcttcgatccggtcaagggcatgttcctggcc
gaccgcaacatcaagggcgaatgcccgaaatgcggcgccaagaaccagtacggcgacaat
tgcgaagtgtgcggcgcggcctaccagccgaccgacctggtcaatccgttctcggtgttc
accaatgcgacgcccgtgatgaagccgtcggaacagtatttcttcaagctgtccgacccg
cgctgcttcgaattcctcaaggattggctgaatacgccaggccgcttgcagccggagatg
gtcaacaaggtcagcgaatggctgggcgaagcgggcgaaaagctggctgactgggatatt
tcgcgcgacgcaccctacttcggcatcccgattcccgatgcgccgggcaagttcttctat
gtgtggatggatgcgcccgtcggttacctggccagcctgaaaaactattgcgacaagaaa
ggcatcgatttcgacgccttcctgaatgacccgtcgacggaacagatccacttcatcggc
aaggatatcgtctccttccatttgctgttctggcccgccatgctgaagttcgccaatcac
ccggtgatcgacaaactgaaagtcaacgtccacggcttcctgacggtcaacaacgaaaag
atgtcgaagtcgcgcggcaccggcatttcgccgctgcgctacctggacctgggcatgaac
ccggaatggctgcgctattacatcgccttcaagctgaactcgaaagtggaagacctggac
ttcaacggcgaagattttgtcgcccgcgtaaacagcgacctgatcggcaaatacgtgaac
atcgccagccgctgcgccggcttcatcgccaagcgtttcgacggcaagctggcgagcacc
ctgtcggaaggcgcgcaaagctggatcaaccgcgcgctgacggtggacgtgaatggcgtc
atcgtcgagcgccaggccagcatcgccgcgcacttcgagaaccgcgaattcggcaaggcc
ttgcgcgaaatcatggaaatcgccgacatcaccaaccagtatgtcgatgaaaacaagccg
tggatcctcgccaaggatgcggaaaaaacagccgagttgcacgacgtgtgcaccacggcc
ctgatcctgttccgccagctgactatcttgttgtcgcctgtgctgccgggtgtggccaag
aacgtggcctcgttcctcaacgacgccgcgttcagctgggcggatacgcaagtgttcggc
gacgccgtcgcaaacagcatgctgggccgtaccatcggcgcctacagccatttgatgaca
cgcatggatgcaaagatgatcgaagcgctgtttgacgcgccgcaagcagcccccgccatt
gccgcgccggccggcgacgccgccaacgacgctgcagcgcctgaagctgccaccgctgcc
gccatcgaagaactggcgcccgagatcaagatcgacgacttcctcaagatcgacctgcgc
atcgccaaaatcgtcaactgcgaactggtcgaaggttccgacaagctgctgcgcctgacg
ctggatgcgggcgaaggccgcttgcgcaatgtcttctcgggcatccgctcggcgtaccag
ccggaagagctggtcggcaagctgacggtactggtggccaacctggcgccgcgcaagatg
aagttcggcatttcggaaggcatggtcatggctgcgtccgccgccgacgagaagaccaat
ccgggcatctacatcctgaacccgtggccgggcgccgaacctggcatgcgcatccgctaa

DBGET integrated database retrieval system