KEGG   Janthinobacterium svalbardensis: CNX70_11835Help
Entry
CNX70_11835       CDS       T05119                                 

Definition
(GenBank) maltose ABC transporter permease MalF
  KO
K10109  maltose/maltodextrin transport system permease protein
Organism
jsv  Janthinobacterium svalbardensis
Pathway
jsv02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:jsv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CNX70_11835
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:jsv02000]
    CNX70_11835
Transporters [BR:jsv02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter
    CNX70_11835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MalF_P2 BPD_transp_1 TM_PBP2_N
Motif
Other DBs
NCBI-ProteinID: ATD60779
UniProt: A0A290WV40
Position
complement(2635878..2637389)
Genome map
AA seq 503 aa AA seqDB search
MRKFIGPTVLTISMALGLYLLFMLYISGQTMLAAVFLGLLTLTTFVFTSPRAYAYRYLFP
GITAVIVFVLLPMVYTVSIGFTNFSSRNLLTYERATQYLLDETQRVESTGYALTVHPDNK
EYRLRLESPDTGEVLLTPPLALKRAVPLTVEVAPPDPVQAPVLAPPLPIKDIIALQKDLK
QLTLVMPNKIELRMVGLREFGPVAHVYKQLPDKTLKKIATGELVKPNFKTGFYEMPDGTK
LEPGFKVNVGFANFVKIFSDEAFRGPFLRIFVWTIVFALISVATTTGLGMVLAVLLNWDA
LRFRGLYRTLLFLPYAVPGFISILVFKGLFNNNFGEINLVLDALFGIKPAWFSDTTLAKA
MILIVNTWLGYPYMMVVCMGLIKAIPSDLYEASALAGAGPLTNFFKITLPLIIKPLTPLM
VASLGFNFNNFVLISLLTGGRPDFLDTTLPAGTTDLLVSYTYRIAFEDSGQNFGLAAAIS
TLIFFLVAAISLVNMRLTRMNKA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaagtttatcggccctacggtattgaccatcagcatggcgctgggtctgtatctg
ctcttcatgttgtacatttccggccagaccatgctggccgccgttttcctcggcttgctg
accctgacgacgtttgtcttcacgtcgccgcgcgcctatgcctaccgttatctgtttccc
ggcatcacggcggtcatcgtcttcgtgctgctgccgatggtgtacacggtgtcgatcggc
tttaccaatttcagttcgcgcaacctgctcacctatgagcgggccacgcaatatttgctg
gacgagacgcagcgcgtggaaagcacgggctacgcgctgacagtgcacccggacaacaag
gaataccgcttgcgcctggaaagcccggacacgggcgaagtgctgctgacgccgccgctg
gccctgaagcgcgccgtgcctttgaccgtggaagtggcgccgcctgaccccgtgcaggcg
cccgtgctggccccgccgctgcccatcaaggacatcatcgcgctgcaaaaggatttgaaa
cagctcaccttggtcatgccgaacaaaatcgagctgcgcatggtgggcttgcgcgaattc
ggccccgtcgcgcatgtctacaagcagctgcccgacaaaaccctgaagaagatcgccacg
ggcgaactggtcaaaccgaacttcaagacgggcttttatgaaatgcccgatggcacgaaa
ctggaaccgggcttcaaggtcaatgtcggcttcgccaacttcgtgaagattttctccgat
gaagcgttccgtggccccttcctgcgcattttcgtctggaccatcgttttcgcgctgatc
agcgtggccaccacgacgggcctgggcatggtgctggccgtgctcttgaactgggatgcg
ctgcgcttccgcggcctgtaccgcaccctgctgttcctgccctacgccgtaccgggcttc
atttccattctggtcttcaagggcttgttcaacaacaactttggcgaaatcaacctggtg
ctcgacgccctgttcggcatcaagcccgcctggttctcggataccaccctggccaaggcc
atgattttgatcgtcaatacctggctcggttacccctacatgatggtggtgtgcatgggc
ttgatcaaggcgattccgtcggacctgtacgaagcgtcggccctggccggtgcgggaccg
ctgacgaatttcttcaagatcaccttacccctgatcatcaagccactgacgccgctgatg
gtggccagcctgggtttcaatttcaataattttgtgctgatcagcttgctgacgggcggg
cgtcccgatttcctcgacacgaccttaccggccggcacgacggacttgctcgtgtcctac
acctaccgcatcgcgttcgaggattccggccagaactttggcctggccgccgccatctcg
accctgatcttcttcctcgtggccgcgatttcgctggtcaacatgcgcctgacgcgcatg
aacaaagcataa

DBGET integrated database retrieval system