KEGG   Janthinobacterium svalbardensis: CNX70_23090Help
Entry
CNX70_23090       CDS       T05119                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
jsv  Janthinobacterium svalbardensis
Pathway
jsv00030  Pentose phosphate pathway
jsv00480  Glutathione metabolism
jsv01100  Metabolic pathways
jsv01110  Biosynthesis of secondary metabolites
jsv01120  Microbial metabolism in diverse environments
jsv01130  Biosynthesis of antibiotics
jsv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:jsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CNX70_23090 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CNX70_23090 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:jsv04147]
    CNX70_23090 (zwf)
Enzymes [BR:jsv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     CNX70_23090 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     CNX70_23090 (zwf)
Exosome [BR:jsv04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CNX70_23090 (zwf)
  Exosomal proteins of colorectal cancer cells
   CNX70_23090 (zwf)
  Exosomal proteins of bladder cancer cells
   CNX70_23090 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ATD62702
UniProt: A0A290X0M9
Position
5192329..5193801
Genome map
AA seq 490 aa AA seqDB search
MALTDFDLVLFGGSGDLAMRKLLPAMYARDVANDLPPTARIICVGRQDSGQDAFLKMVET
NSRPHIKASTLNAATWSKFCARIVYVSLNASDATTYAPLVEALRGDAELTRVYYLATPPH
LFALICDNLEDNGLVTPNSRVVLEKPLGRDLASAKQINAEVGKVFQESQIYRIDHYLGKE
TVQNLLALRFGNILFEPLWRREWISDVQITIAEKLGVGNRMGYYDTSGALRDMLQNHLLQ
LLCIVAMEPPTSIAPDAVRDEKLQVLRSLKKFTPTTLAQNIVRGQYRAGHVDGATVPSYR
DEPDAPEHSRTETFVALKAEIDTWRWAGVPFYLRTGKRMADSLAEIVVRFKQIPHSIFNQ
PTSSFQPNCLVIRLQPDEGLRMNLMAKTPGDGMRLKPAELELDFRESFKTPRMDAYERLL
LDVLRGQLTLFMRGDELEAAWEWVEPILDHWEQNDSAPIPYTAGTWGPAAASALIGRDGL
QWREEALPED
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcacttaccgattttgacctggtcctgtttggcggcagcggcgatttagcaatgcgc
aagttgctgcctgcaatgtatgcgcgcgacgtcgcgaacgatttgccgccgacggcgcgc
atcatctgtgtgggccgccaggacagcggccaggatgccttcctgaagatggtagagacc
aactcgcgtccccacatcaaggccagcaccctgaatgccgccacctggagcaaattctgc
gcgcgcatcgtgtatgtgtcgctcaacgccagcgatgcaacaacgtatgcgccgctggtc
gaagcgctgcgcggcgatgccgagctgacccgcgtgtactacctggcgacgccgccgcac
ttgtttgccttgatctgcgacaacctggaagacaatggcctggtcacgccgaattcgcgc
gtggtgctggaaaagccgctgggccgcgacttggccagcgccaagcagatcaatgccgaa
gtgggcaaggtcttccaggaatcgcagatctaccgtatcgaccattacctgggcaaggaa
accgtgcagaacttgctggccctgcgcttcggcaatatcctgttcgaaccgctgtggcgc
cgcgaatggatttccgacgtgcagatcaccatcgccgagaaactgggcgtgggcaaccgc
atgggttactacgacacttcgggcgcgctgcgcgacatgctgcagaaccacttgctgcaa
ctgctgtgcatcgtcgccatggaaccgccgacctcgatcgcgccggacgccgtgcgtgat
gaaaagctgcaagtgctgcgctcgctgaaaaaattcacgcccaccaccctggcgcaaaac
atcgtgcgcggccagtaccgcgccggccacgtcgatggcgccaccgtgccgagctaccgc
gacgagccggatgcaccggaacattcgcgcaccgaaaccttcgtcgcgctgaaggcggaa
atcgacacctggcgctgggccggcgtgccgttctacctgcgcacgggcaagcgcatggcc
gacagcctggccgaaatcgtcgtgcgcttcaagcagatcccgcactcgatcttcaaccag
cccacctccagcttccagccgaattgcctggtcatccgtttgcagccggacgaaggcttg
cgcatgaacctgatggcgaaaaccccgggcgacggcatgcgattgaaaccggcggaactg
gaactcgatttccgcgaatcgttcaagacgccgcgcatggacgcctacgagcgcctgctg
ctcgacgtgctgcgcggccagctgaccctgttcatgcgcggcgacgaactggaagcggcc
tgggaatgggtcgagccgatactcgaccactgggaacagaacgacagcgcgccgattccg
tacacggccggcacctggggcccggccgcggccagcgccctgatcggccgcgatggcttg
cagtggcgtgaagaagccttacctgaggattaa

DBGET integrated database retrieval system