KEGG   Janibacter indicus: ASJ30_12125Help
Entry
ASJ30_12125       CDS       T04569                                 

Definition
(GenBank) mycothiol conjugate amidase Mca
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
jte  Janibacter indicus
Brite
KEGG Orthology (KO) [BR:jte00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ASJ30_12125
Enzymes [BR:jte01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     ASJ30_12125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: APH02182
UniProt: A0A1L3MIM3
Position
complement(2531495..2532427)
Genome map
AA seq 310 aa AA seqDB search
MAVHAHPDDESSKGGATTARYVHDGAEVLVVTCTGGERGDVLNSRLKDDPHIQRDIVEVR
RQEMARAQAALGVQHTWLGFVDSGLPEGDPLPALPDGCFYREPLEVATEALVREIRRFRP
HVMTTYDENGGYPHPDHVMTNRLSVAAFEAAGDPEAFPHAGEPWQPLKLYYIGGFSLDRI
HTFHEALVAAGKESPFVDWIKRAEGRPQRTLTTWVECSAFFDARDEALRSHATQIDPDGF
FFAVPNDVQADLWPTEEYELAISLVETSLPEDDLFAGVPASLAEADALGARTDLTAVHDT
RTAPTVREWQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgcacgcacaccccgacgacgagtcgagcaagggtggggcgacgaccgcccgc
tacgtccacgacggcgccgaggtgctcgtcgtgacgtgcacgggtggtgagcgcggcgac
gtgctcaactccaggctcaaggacgacccgcacatccagcgcgacatcgtcgaggtgcgg
cgtcaggagatggcgcgggcgcaggccgccctcggggtccagcacacctggctcggcttc
gtcgactccggcctgcccgagggcgacccactgcccgcgctgcccgacggctgcttctac
cgtgagccgctcgaggtggcgaccgaggcgctcgtgcgcgagatccgccgcttccgcccg
cacgtcatgacgacctacgacgaaaacgggggctacccgcaccccgaccacgtcatgacc
aatcgcttgagcgtcgcggccttcgaggcggccggcgaccccgaggccttcccgcacgcc
ggcgagccctggcagccgctcaagctctactacatcggcggcttcagcctcgaccggatc
cacaccttccacgaggcgctcgtcgcagcgggcaaggagtcccccttcgtcgactggatc
aagcgcgccgagggtcgaccgcagcgcacgctgacgacatgggtcgagtgctcggccttc
ttcgacgcccgtgacgaggccctgcgctcgcacgcgacgcagatcgatcccgatggcttc
ttcttcgccgtgcccaacgacgtgcaggccgacctgtggccgaccgaggagtacgagctg
gcgatcagcctcgtcgagacctcgctgcccgaggacgacctcttcgccggggtcccggcg
agcctggccgaggccgacgccctcggtgcgcgcaccgacctgaccgcggtccacgacacg
cggaccgcaccgaccgtgagggagtggcagtga

DBGET integrated database retrieval system