KEGG   Kitasatospora albolonga: B7C62_03365Help
Entry
B7C62_03365       CDS       T05009                                 

Definition
(GenBank) mannose-1-phosphate guanyltransferase
  KO
K16881  mannose-1-phosphate guanylyltransferase / phosphomannomutase [EC:2.7.7.13 5.4.2.8]
Organism
kab  Kitasatospora albolonga
Pathway
kab00051  Fructose and mannose metabolism
kab00520  Amino sugar and nucleotide sugar metabolism
kab01100  Metabolic pathways
kab01110  Biosynthesis of secondary metabolites
kab01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:kab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    B7C62_03365
   00520 Amino sugar and nucleotide sugar metabolism
    B7C62_03365
Enzymes [BR:kab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     B7C62_03365
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.8  phosphomannomutase
     B7C62_03365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase PGM_PMM_II PGM_PMM_I NTP_transf_3 Hexapep PGM_PMM_III IspD
Motif
Other DBs
NCBI-ProteinID: ARF71402
UniProt: A0A1V0V1P0
Position
complement(789448..791943)
Genome map
AA seq 831 aa AA seqDB search
MKAVVMAGGEGTRLRPMTSSMPKPLLPVANRPIMEHVLRLLKRHGLNETVVTVQFLASLV
KNYFGDGEELGMELTYANEEKPLGTAGSVKNAEEALKDDTFLVISGDALTDFDLTDLIAF
HKEKGGLVTVCLTRVPNPLEFGITIVDENGQVERFLEKPTWGQVFSDTVNTGIYVMEPEV
FDYVQADTSVDWSGDVFPQLMKEGKPIYGYIAEGYWEDVGTHESYVKAQADVLERKVDVE
LDGFEISPGVWVAEGAEVHPDAVLRGPLYIGDYAKVEADVEIREHTVVGSNVVVKTGAFL
HKAVVHDNVYIGQHSNLRGCVVGKNTDIMRAARIEDGAVIGDECLVGEESIIQGNVRVYP
FKTIEAGAFVNTSVIWESRGQAHLFGARGVSGILNVEITPELAVRLAGAYATTLKKGATV
TTARDHSRGARALKRAVISALQASAIDVRDLENVPLPVARQQTARGSAGGIMIRTSPGVP
DSVDIMFIDERGADLSQAQQRKLDRVYARQEYRRAFPGEIGDLHFPSSVFDSYTGSLLRN
VDIAGIADSGLKVVVDASNGSAGLVLPSLLGRLGVDALTINPGLDEARPTESAETRRAGL
VRLGEIVSSARAAFGVRFDPVGERLSLVDELGRIIEDDRALLVMLDLVAAERRSGRVALP
VTTTRVAEQVAAYHGTQVEWTTTSPDDLTRVGREETTIFGGDGRGGFIVPEFSSVFDGTA
AFVRLIGLVARTQLTLSQIDARIPRAHVLRRDLATPWAVKGLVMRRVVEAAGDRSVDTTD
GVRVVEADGRWIMVLPDRAEAVTHLWAEGPDDASAQALLDEWSAVVESAGE
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgtcgtgatggctggtggcgagggcacacgcctgcgccccatgacctcgagc
atgcccaagccgctcctgcccgtggccaaccggccgatcatggagcatgtcctgcggctt
ctcaagaggcatgggctcaatgaaacagtagttactgtccagtttctcgcctccctcgtc
aagaactatttcggggacggcgaggagctcgggatggagctcacctatgccaacgaggag
aagccactcggcaccgcggggagtgtgaagaacgccgaggaggcgttgaaggacgacacc
ttcctcgtcatttccggtgacgctctcaccgacttcgacctcaccgatctcatcgccttc
cacaaggagaagggcggactcgtcacggtctgtctgacccgggtccccaatccgctggaa
ttcggcatcaccatcgtggacgagaacggtcaggtcgaacgctttctggagaagccgacc
tggggccaggtcttctcggacacggtgaacacgggcatctacgtcatggagcccgaggtc
ttcgactacgtccaggccgatacctccgtcgactggtcgggtgatgtcttcccgcagctg
atgaaggaaggcaagccgatctacggctatatcgccgagggctactgggaggacgtcggt
acgcacgagagttatgtgaaggcccaggcggatgtcctggagcgcaaggtcgacgtggag
ctcgacgggttcgagatctcgcccggtgtgtgggtcgccgaaggcgcggaggtccacccg
gacgccgtactccgcgggccgctgtacatcggcgactacgccaaggtcgaggccgacgtc
gagatccgcgagcacacggtggtgggctccaacgtcgtcgtcaagaccggtgccttcctt
cacaaggccgtcgtccacgacaacgtctacatcgggcagcacagcaacctccggggctgc
gtggtcggcaagaacaccgacatcatgcgcgcggcccggatcgaggacggcgctgtcatc
ggtgacgaatgcctggtcggcgaggagtcgatcatccagggcaacgtacgggtgtacccg
ttcaagaccatcgaggccggtgcgttcgtcaacacctcggtgatctgggagtcccgtggg
caggcgcatctcttcggggcgcgcggggtctccggcatcctgaacgtcgagatcaccccc
gagctggcggtccggctcgcgggcgcctacgccaccaccctcaagaagggcgcgacggtc
accaccgcccgtgaccactcccgaggcgcgcgggcgctcaagagggccgtgatctcggcg
ctccaggccagcgccatcgacgtacgcgacctggagaacgtaccgctgcccgtcgcccgg
cagcagacggcgcgggggagtgcgggcgggatcatgatccgtacgtcgccgggggtgccc
gactcggtggacatcatgttcatcgacgagcggggcgccgacctctcgcaggcccagcag
cgcaagctcgaccgggtgtacgcgaggcaggagtaccgcagggcgtttcccggggagatc
ggcgacctgcacttcccgtccagcgtcttcgactcgtacaccggctccctgctccgcaac
gtcgacatcgcgggcatcgccgactccgggctcaaggtcgtcgtggacgcctccaacggg
tccgccgggctcgttctgccgagcctcctcgggcggctcggggtggacgcgctgacgatc
aacccggggctcgacgaggcgcggcccaccgagtccgccgagacccgccgcgccggcctc
gtacgcctcggggagatcgtctcctcggcgcgggcggccttcggcgtgcggttcgacccc
gtgggcgagcggctctccctcgtggacgagctcggccggatcatcgaggacgaccgggcc
ctgctggtcatgctggacctcgtcgccgccgaacggcgcagtggacgcgtcgccctgccg
gtgaccaccacgcgcgtggccgagcaggtggcggcgtaccacggcacgcaggtggagtgg
acgaccacctcgcccgacgacctgacccgggtggggcgcgaggaaaccaccatcttcgga
ggagacgggcgcggcgggttcatcgttcccgaattcagcagcgtcttcgacgggacggcc
gctttcgtccggctcatcggtctcgtcgcccgcacccagctcaccctgagccagatcgac
gcccgcattccccgggcccatgtcctgcgccgcgatctcgcgacgccctgggcggtcaag
ggcctcgtcatgcgccgggtcgtcgaggcggccggggaccgcagcgtggacaccacggac
ggcgtccgggtggtcgaggcggacggccggtggatcatggtgctgcccgaccgtgcggag
gccgtcacccatctgtgggcggagggcccggacgacgcctcggcgcaggcgctgctcgac
gagtggtccgccgtggtggagagcgccggcgagtga

DBGET integrated database retrieval system