KEGG   Kitasatospora albolonga: B7C62_12855Help
Entry
B7C62_12855       CDS       T05009                                 

Definition
(GenBank) SDR family oxidoreductase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
kab  Kitasatospora albolonga
Pathway
kab00053  Ascorbate and aldarate metabolism
kab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    B7C62_12855
Enzymes [BR:kab01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     B7C62_12855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd NAD_binding_10 3Beta_HSD Polysacc_synt_2 adh_short RmlD_sub_bind adh_short_C2 NmrA KR
Motif
Other DBs
NCBI-ProteinID: ARF73056
UniProt: A0A1V0V6E1
Position
2990304..2991065
Genome map
AA seq 253 aa AA seqDB search
MNGPLLITGSSGTIGTRLVTDLAAHGIPLRLLDRRPPIRLPPTDAEFVQADLREASAVER
GVAGAGAVIHLAGIAEEAPFAEVVEHNITATHLLLEAARRHNIPRIVLASSHHVIGMNPI
GATAAPMAPDSFYAVSKIALEALGHLYAHKTGMEVVAVRIGSHRTHPTEPRHRATWLSPR
DTTALLYAAATRPLPTRFLTLYGTSDNSENWWPRTGWDALGYRPADNAARHPRTGPLTDR
WTGGAFADQDLPT
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaacgggccgctcctgatcaccgggtccagcggcaccatcggcacccgcctcgtcacc
gacctggctgcccatggcataccgctacggctcctcgaccgacgaccacccatccgcctc
ccacccaccgacgccgaattcgtccaggcagacctccgggaggcgagtgccgtcgagagg
ggcgtagcaggagcgggggcggtgatccacctcgcgggcatcgccgaagaggcccccttc
gccgaggtggtcgagcacaacatcaccgccacccaccttctcctcgaagccgcccgccgc
cacaacatcccccgcatcgtgctcgccagcagccaccacgtcatcggtatgaaccccatc
ggcgcgacggcggctcccatggccccggacagcttctacgccgtcagcaagatcgccctc
gaagccctcggccacctctacgcccacaagaccggtatggaggtcgtcgccgtacgaatc
ggcagccaccgcacccatcccaccgagccccgccaccgcgcaacctggctcagcccccgc
gacaccaccgccctgctctacgccgccgccaccagacccctgccgacccgcttcctcacc
ctgtacggcacctcggacaactccgagaactggtggccacgcaccggctgggacgccctc
ggctaccgacccgccgacaacgccgcccgccacccccgaaccgggccgctcaccgaccgc
tggaccggcggggccttcgccgaccaggacctccctacctaa

DBGET integrated database retrieval system