KEGG   Kitasatospora albolonga: B7C62_15450Help
Entry
B7C62_15450       CDS       T05009                                 

Definition
(GenBank) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
kab  Kitasatospora albolonga
Pathway
kab00230  Purine metabolism
kab00250  Alanine, aspartate and glutamate metabolism
kab01100  Metabolic pathways
Module
kab_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:kab00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    B7C62_15450
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B7C62_15450
Enzymes [BR:kab01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     B7C62_15450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: ARF73502
UniProt: A0A1V0V7Q4
Position
complement(3577248..3578531)
Genome map
AA seq 427 aa AA seqDB search
MPALVLLGAQWGDEGKGKATDLLGGSVDYVVRYQGGNNAGHTVVVGDQKYALHLLPSGIL
SPGCTPVIGNGVVVDPAVLLSELSGLNERGVDTSKLLISGNAHLITPYNVTLDKVSERFL
GKRKIGTTGRGIGPTYADKINRVGIRVQDLYDESILVQKVEAALEQKNQLLAKVFNRRAI
EAGKVVEDMLQYAEQIKPFVADTTLILNDAIDEGKVVLFEGGQGTLLDVDHGTYPFVTSS
NPTAGGACTGAGVGPTKITRVIGILKAYTTRVGAGPFPTELFDEDGEALRRIGGERGVTT
GRDRRCGWFDAPIARYATRVNGLTDFFLTKLDVLTGWEQIPVCVAYEIDGKRVEELPYNQ
TDFHHAKPIYENLPGWSEDITKAKTFSDLPKNAQAYVKALEEMSGAPISAIGVGPGRTET
IEINSFL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgcacttgtgctgctcggtgctcagtggggtgacgagggcaaggggaaggccacc
gatctcctcggtggttccgtggactatgtcgtgcgataccaaggcgggaacaacgccggt
cacacggtcgtcgtgggcgaccagaagtacgcactgcatctcctcccctccggaatcctg
tcgccgggctgtaccccggtcatcgggaacggtgtcgtggtcgacccggcggtcctgctc
tccgagctgagcggtctgaacgagcgaggcgtcgacacgtccaagcttctgatcagcggc
aacgctcatttgatcactccgtacaacgtcacgctcgacaaggtgagcgagcgcttcctc
ggcaagcgcaagatcggcacgacgggccgcggtatcggtccgacgtacgccgacaagatc
aaccgggtgggcatccgcgtccaggacctctacgacgagtcgatcctggtgcagaaggtc
gaggccgccctggagcagaagaaccagctcctggccaaggtcttcaaccgccgggccatc
gaggccggcaaggtcgtcgaggacatgctccagtacgcggagcagatcaagccgttcgtc
gccgacacgaccctgatcctgaacgatgcgatcgacgagggcaaggtcgtgctcttcgag
ggcggccagggcacgctgctcgacgtcgaccacggcacgtaccccttcgtcacctcgtcg
aacccgacggcgggcggcgcctgcaccggtgccggtgtcggcccgacgaagatcacccgt
gtcatcggcatcctcaaggcttatacgacgcgggtgggcgccggtccgttcccgacggag
ctgttcgacgaggacggcgaggcgctgcggcgcatcggcggcgagcgtggtgtcaccacc
ggccgtgaccgccgctgcggctggttcgacgccccgatcgcgcggtacgcgacccgggtc
aacggcctgaccgacttcttcctcaccaagctggacgtgctcaccggctgggagcagatc
ccggtctgtgtggcgtacgagatcgacggcaagcgcgtcgaggaactcccgtacaaccag
accgacttccaccacgcgaagccgatctacgagaacctgccgggctggtccgaggacatc
accaaggccaagaccttctccgatctgccgaagaacgcgcaggcgtacgtgaaggccctg
gaggagatgtcgggcgccccgatctccgcgatcggcgtcggtcccggccggaccgagacg
atcgagatcaactccttcctgtag

DBGET integrated database retrieval system